3EU9: Huntingtin-interacting protein 14

The ankyrin repeat domain of Huntingtin interacting protein 14. Determined by X-ray diffraction at 1.99 Å resolution. Released 23 Jun 2009.

Method: X-ray diffraction
Resolution: 1.99 Å
Organism: Homo sapiens
Chains: 3
Atoms: 5,620
Mol. weight: 81.62 kDa
Ligands: HIS
Released: 23 Jun 2009

Explore 3EU9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EU9 contains 44 α-helices and 12 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	56-58	3
α-helix	61-66	6
α-helix	70-78	9
α-helix	93-99	7
α-helix	103-111	9
β-strand	120	1	1
β-strand	125	1	1
α-helix	127-134	8
α-helix	137-145	9
α-helix	160-166	7
α-helix	170-178	9
α-helix	193-200	8
α-helix	207-212	6
α-helix	228-235	8
α-helix	238-247	10
β-strand	254	1	2
β-strand	260	1	2
α-helix	261-267	7
α-helix	271-280	10

Chain B: 15 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	56-58	3
α-helix	61-66	6
α-helix	70-78	9
α-helix	93-99	7
α-helix	103-111	9
β-strand	120	1	3
β-strand	125	1	3
α-helix	127-134	8
α-helix	137-144	8
α-helix	160-166	7
α-helix	170-179	10
α-helix	193-200	8
α-helix	207-212	6
β-strand	220	1	4
β-strand	227	1	4
α-helix	228-234	7
α-helix	238-246	9
α-helix	262-268	7
α-helix	271-278	8

Chain C: 14 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	61-66	6
α-helix	70-78	9
α-helix	93-99	7
α-helix	103-111	9
β-strand	120	1	5
β-strand	125	1	5
α-helix	127-134	8
α-helix	137-145	9
α-helix	160-166	7
α-helix	170-178	9
α-helix	193-200	8
α-helix	207-212	6
β-strand	220	1	6
β-strand	227	1	6
α-helix	228-234	7
α-helix	238-246	9
α-helix	261-268	8
α-helix	271-283	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Huntingtin-interacting protein 14	A, B, C	protein	240	Homo sapiens	Q8IUH5 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3EU9_1 Huntingtin-interacting protein 14 (chains A, B, C)
HMTHIDDYSTWDIVKATQYGIYERCRELVEAGYDVRQPDKENVTLLHWAAINNRIDLVKY
YISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFG
HTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTA
LHWAVLAGNTTVISLLLEAGANVDAQNIKGESALDLAKQRKNVWMINHLQEARQAKGYDN

Ligands and cofactors

ID	Name	Formula	Copies
HIS	Histidine	C6 H10 N3 O2	1

Water and common crystallization additives (SO4, GOL) are not listed.

Primary citation

The ankyrin repeat domain of Huntingtin interacting protein 14 contains a surface aromatic cage, a potential site for methyl-lysine binding. Gao, T., Collins, R.E., Horton, J.R. et al. Proteins (2009) 76:772-777. DOI 10.1002/prot.22452 · PubMed

Other PDB entries of the same protein (UniProt Q8IUH5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W7I 2.1 Å, X-ray structure of ankyrin repeat domain of DHHC17 in complex with Snap25b peptide
5W7J 2.2 Å, X-ray structure of the E89A variant of ankyrin repeat domain of DHHC17 in complex with…

Browse structure collections

About this viewer

MolViewer shows 3EU9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.