3EVV: Calcium bound dimeric GCAMP2

Crystal Structure of Calcium bound dimeric GCAMP2 (#2). Determined by X-ray diffraction at 2.6 Å resolution. Released 9 Dec 2008.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Aequorea victoria, Homo sapiens
Chains: 1
Atoms: 3,132
Mol. weight: 51.47 kDa
Ligands: CA
Released: 9 Dec 2008

Explore 3EVV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EVV contains 16 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	40-57	18
β-strand	63-68	6	1
α-helix	69-71	3
β-strand	73-83	11	1
β-strand	84	1	2
β-strand	89-100	12	1
α-helix	108-110	3
β-strand	112-121	10	1
β-strand	130-140	11	1
α-helix	164-166	3
β-strand	170-180	11	1
β-strand	183-194	12	1
β-strand	199-206	8	1
α-helix	215-218	4
α-helix	227-229	3
β-strand	231	1	1
α-helix	234-236	3
α-helix	241-244	4
β-strand	250-258	9	1
β-strand	263-272	10	1
β-strand	277-286	10	1
β-strand	299	1	2
α-helix	309-322	14
β-strand	329-330	2	3
α-helix	332-341	10
α-helix	348-358	11
β-strand	366-367	2	3
α-helix	368-375	8
α-helix	386-395	10
β-strand	402-403	2	4
α-helix	405-414	10
α-helix	421-429	9
β-strand	439-440	2	4
α-helix	441-447	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin light chain kinase, Green fluorescent protein, Calmodulin chimera	A	protein	451	Aequorea victoria, Homo sapiens	P0DP29 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3EVV_1 Myosin light chain kinase, Green fluorescent protein, Calmodulin chimera (chains A)
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDLATMVDSSRRKWNKTGHAVRAIGRLSSL
ENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKL
SKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGTGGSMVSKGEELFTGVVPILVELDGDV
NGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLXXXVQCFSRYPDHMKQHD
FFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLE
YNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA
DGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLT
DEEVDEMIREADIDGDGQVNYEEFVQMMTAK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

Structural Basis for Calcium Sensing by GCaMP2. Wang, Q., Shui, B., Kotlikoff, M.I. et al. Structure (2008) 16:1817-1827. DOI 10.1016/j.str.2008.10.008 · PubMed

Other PDB entries of the same protein (UniProt P0DP29 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PQ3 1.3 Å, N-Terminal Calmodulin Zn-Trapped Intermediate
4J9Y 1.51 Å, Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance…
1G4Y 1.6 Å, 1.60 a crystal structure of the gating domain from small conductance potassium channel…
3B32 1.6 Å, Crystal Structure of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues…
4G28 1.63 Å, Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance…
4G27 1.65 Å, Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance…
4J9Z 1.66 Å, Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance…
9M6G 1.7 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK-Mint1-CID complex
9KYS 1.76 Å, the Ca2+/CaM-CASK-ARD complex
6MBA 1.8 Å, Crystal Structure of Human Nav1.4 CTerminal Domain in Complex with apo Calmodulin
9M5Y 1.8 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK complex
9U9D 1.8 Å, Bipartite Genetically Encoded Biosensor sG-GECO1

Browse structure collections

About this viewer

MolViewer shows 3EVV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.