3EYS: PFA1 Fab fragment

PFA1 Fab fragment complexed with pyro-Glu3-A-Beta (3-8). Determined by X-ray diffraction at 1.95 Å resolution. Released 12 May 2009.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Mus musculus
Chains: 3
Atoms: 3,495
Mol. weight: 48.91 kDa
Released: 12 May 2009

Explore 3EYS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EYS contains 17 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	11-12	2	8
β-strand	18-25	8	7
β-strand	35-41	7	9
β-strand	48-54	7	9
β-strand	59-61	3	9
α-helix	63-68	6
β-strand	69-74	6	7
β-strand	79-84	6	7
α-helix	89-91	3
β-strand	93-99	7	9
β-strand	113	1	9
β-strand	117-119	3	9
β-strand	120-121	2	8
α-helix	124-126	3
β-strand	127	1	10
α-helix	128-129	2
β-strand	130-134	5	11
β-strand	145-155	11	11
β-strand	156	1	10
β-strand	161-164	4	12
α-helix	165-167	3
β-strand	169	1	12
β-strand	173-175	3	11
α-helix	176-178	3
β-strand	179	1	11
β-strand	185-194	10	11
β-strand	204-209	6	12
α-helix	210-212	3
β-strand	214-219	6	12

Chain L: 10 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	30	1	3
β-strand	36	1	3
β-strand	38-43	6	2
β-strand	50-54	5	2
β-strand	58-59	2	2
α-helix	60	1
β-strand	67-72	6	1
β-strand	75-80	6	1
α-helix	85-87	3
β-strand	89-95	7	2
α-helix	101	1
β-strand	102-103	2	2
β-strand	107-111	5	2
β-strand	116	1	4
α-helix	117-118	2
β-strand	119-123	5	5
α-helix	124-126	3
α-helix	127-130	4
β-strand	134-144	11	5
β-strand	145	1	4
β-strand	149-155	7	6
β-strand	158-160	3	6
β-strand	164-168	5	5
α-helix	169-172	4
β-strand	178-187	10	5
α-helix	188-192	5
β-strand	196-203	8	6
α-helix	209	1
β-strand	210-215	6	6
α-helix	216-218	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
If kappa light chain	L	protein	219	Mus musculus	A2NHM3 (AlphaFold model)
PFA1 Fab Heavy Chain	H	protein	223	Mus musculus
pyro-Glu3-A-Beta (3-8) peptide	Q	protein	6

Sequence of entity 1 (L), FASTA

>3EYS_1 If kappa light chain (chains L)
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>3EYS_2 PFA1 Fab Heavy Chain (chains H)
AVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDDRS
YNPSLKSQLTISKDAARNQVFLRITSVDTADTATYYCVRRAHTTVLGDWFAYWGQGTLVT
VSAAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVL
QSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR

Sequence of entity 3 (Q), FASTA

>3EYS_3 pyro-Glu3-A-Beta (3-8) peptide (chains Q)
QFRHDS

Primary citation

Structures of Abeta-related peptide--monoclonal antibody complexes. Gardberg, A., Dice, L., Pridgen, K. et al. Biochemistry (2009) 48:5210-5217. DOI 10.1021/bi9001216 · PubMed

Other PDB entries of the same protein (UniProt A2NHM3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PXR 1.56 Å, Anti-TAU BIIB092 FAB with TAU peptide
4TPR 1.6 Å, Structure of Tau5 antibody Fab fragment
4TQE 1.6 Å, Structure of tau peptide in complex with Tau5 antibody Fab fragment
3V4U 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3UO1 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2IPU 1.65 Å, PFA1 Fab fragment complexed with Abeta 1-8 peptide
3V52 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2DQU 1.7 Å, Crystal form II: high resolution crystal structure of the complex of the hydrolytic…
3UYR 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
1ZEA 1.78 Å, Structure of the anti-cholera toxin antibody Fab fragment TE33 in complex with a D-peptide
1PZ5 1.8 Å, Structural basis of peptide-carbohydrate mimicry in an antibody combining site
2DQT 1.8 Å, High resolution crystal structure of the complex of the hydrolytic antibody Fab 6D9 and…

Browse structure collections

About this viewer

MolViewer shows 3EYS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.