3F31: Spectrin alpha chain, brain

Crystal Structure of the N-terminal region of AlphaII-spectrin Tetramerization Domain. Determined by X-ray diffraction at 2.3 Å resolution. Released 13 Oct 2009.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,570
Mol. weight: 35.38 kDa
Released: 13 Oct 2009

Explore 3F31 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3F31 contains 11 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	14-25	12
α-helix	30-66	37
α-helix	78-94	17
α-helix	97-112	16
α-helix	117-146	30

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	9-11	3
α-helix	12-32	21
α-helix	34-66	33
α-helix	78-94	17
α-helix	97-111	15
α-helix	117-143	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spectrin alpha chain, brain	A, B	protein	149	Homo sapiens	Q13813 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3F31_1 Spectrin alpha chain, brain (chains A, B)
GSMDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEK
WIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASE
TIRTRLMELHRQWELLLEKMREKGIKLLQ

Primary citation

Crystal structure of the nonerythroid alpha-spectrin tetramerization site reveals differences between erythroid and nonerythroid spectrin tetramer formation. Mehboob, S., Song, Y., Witek, M. et al. J Biol Chem (2010) 285:14572-14584. DOI 10.1074/jbc.M109.080028 · PubMed

Other PDB entries of the same protein (UniProt Q13813 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZEH 1.3 Å, Structure of PP1-spectrin alpha II chimera [PP1(7-304) + linker (G/S)x9 + spectrin alpha…
5FWC 1.4 Å, Human Spectrin SH3 domain D48G, E7A, K60A
5FWB 1.5 Å, Human Spectrin SH3 domain D48G, E7F, K60F
5FW9 1.55 Å, Human Spectrin SH3 domain D48G, E7Y, K60Y
3FB2 2.3 Å, Crystal structure of the human brain alpha spectrin repeats 15 and 16. Northeast…
2FOT 2.45 Å, Crystal structure of the complex between calmodulin and alphaII-spectrin

Browse structure collections

About this viewer

MolViewer shows 3F31 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.