3FB2: Spectrin alpha chain, brain spectrin

Crystal structure of the human brain alpha spectrin repeats 15 and 16. Northeast Structural Genomics Consortium target HR5563a. Determined by X-ray diffraction at 2.3 Å resolution. Released 25 Nov 2008.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,459
Mol. weight: 51.33 kDa
Released: 25 Nov 2008

Explore 3FB2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FB2 contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	1336-1362	27
α-helix	1372-1389	18
α-helix	1392-1407	16
α-helix	1413-1466	54
α-helix	1489-1513	25
α-helix	1519-1539	21

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	1336-1362	27
α-helix	1371-1390	20
α-helix	1392-1407	16
α-helix	1413-1465	53
α-helix	1480-1513	34
α-helix	1519-1541	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spectrin alpha chain, brain spectrin	A, B	protein	218	Homo sapiens	Q13813 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3FB2_1 Spectrin alpha chain, brain spectrin (chains A, B)
MGHHHHHHSHDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRT
EIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLE
LQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQA
FADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKR

Primary citation

Crystal structure of the human brain alpha spectrin repeats 15 and 16. Vorobiev, S.M., Su, M., Seetharaman, J. et al. To be published.

Other PDB entries of the same protein (UniProt Q13813 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZEH 1.3 Å, Structure of PP1-spectrin alpha II chimera [PP1(7-304) + linker (G/S)x9 + spectrin alpha…
5FWC 1.4 Å, Human Spectrin SH3 domain D48G, E7A, K60A
5FWB 1.5 Å, Human Spectrin SH3 domain D48G, E7F, K60F
5FW9 1.55 Å, Human Spectrin SH3 domain D48G, E7Y, K60Y
3F31 2.3 Å, Crystal Structure of the N-terminal region of AlphaII-spectrin Tetramerization Domain
2FOT 2.45 Å, Crystal structure of the complex between calmodulin and alphaII-spectrin

Browse structure collections

About this viewer

MolViewer shows 3FB2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.