Structural Insights into Lysine Multiple Methylation by SET Domain Methyltransferases, SET8-Y334F / H4-Lys20 / AdoHcy. Determined by X-ray diffraction at 1.6 Å resolution. Released 25 Nov 2008.
Explore 3F9W in 3D Show helices and sheets RCSB PDB PDBe
3F9W contains 31 α-helices and 56 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 195-212 | 18 | |
| β-strand | 218-223 | 6 | 1 |
| β-strand | 227-232 | 6 | 1 |
| α-helix | 235 | 1 | |
| β-strand | 236 | 1 | 2 |
| α-helix | 237 | 1 | |
| β-strand | 241-245 | 5 | 3 |
| β-strand | 248-251 | 4 | 4 |
| α-helix | 252-262 | 11 | |
| β-strand | 272-277 | 6 | 4 |
| β-strand | 280-285 | 6 | 4 |
| α-helix | 294-296 | 3 | |
| β-strand | 298-299 | 2 | 5 |
| β-strand | 305-312 | 8 | 3 |
| β-strand | 315-322 | 8 | 3 |
| β-strand | 326 | 1 | 2 |
| α-helix | 330 | 1 | |
| β-strand | 331 | 1 | 1 |
| α-helix | 332 | 1 | |
| β-strand | 333-334 | 2 | 5 |
| α-helix | 341-346 | 6 | |
| α-helix | 348-351 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 195-212 | 18 | |
| β-strand | 218-223 | 6 | 6 |
| β-strand | 227-232 | 6 | 6 |
| β-strand | 236 | 1 | 7 |
| β-strand | 241-244 | 4 | 8 |
| β-strand | 248-251 | 4 | 9 |
| α-helix | 252-262 | 11 | |
| β-strand | 272-277 | 6 | 9 |
| β-strand | 280-285 | 6 | 9 |
| α-helix | 294-296 | 3 | |
| β-strand | 298-299 | 2 | 10 |
| β-strand | 305-312 | 8 | 8 |
| β-strand | 315-322 | 8 | 8 |
| β-strand | 326 | 1 | 7 |
| α-helix | 330 | 1 | |
| β-strand | 331 | 1 | 6 |
| α-helix | 332 | 1 | |
| β-strand | 333-334 | 2 | 10 |
| α-helix | 341-346 | 6 | |
| α-helix | 348-351 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 195-212 | 18 | |
| β-strand | 218-223 | 6 | 16 |
| β-strand | 227-232 | 6 | 16 |
| β-strand | 236 | 1 | 17 |
| β-strand | 241-245 | 5 | 18 |
| β-strand | 248-251 | 4 | 19 |
| α-helix | 252-262 | 11 | |
| β-strand | 272-277 | 6 | 19 |
| β-strand | 280-285 | 6 | 19 |
| α-helix | 294-296 | 3 | |
| α-helix | 297 | 1 | |
| β-strand | 298-299 | 2 | 18 |
| β-strand | 305-312 | 8 | 18 |
| β-strand | 315-322 | 8 | 18 |
| β-strand | 326 | 1 | 17 |
| α-helix | 330 | 1 | |
| β-strand | 331 | 1 | 16 |
| α-helix | 332 | 1 | |
| β-strand | 333-334 | 2 | 18 |
| α-helix | 341-346 | 6 | |
| α-helix | 348-351 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 20-21 | 2 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone-lysine N-methyltransferase SETD8 | A, B, C, D | protein | 166 | Homo sapiens | Q9NQR1 (AlphaFold model) |
| Histone H4 | E, F, G, H | protein | 10 | P62805 (AlphaFold model) |
>3F9W_1 Histone-lysine N-methyltransferase SETD8 (chains A, B, C, D) GAMGSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYH GDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQ TKLHDIDGVPHLILIASRDIAAGEELLFDYGDRSKASIEAHPWLKH
>3F9W_2 Histone H4 (chains E, F, G, H) AKRHRKVLRD
| ID | Name | Formula | Copies |
|---|---|---|---|
| SAH | S-adenosyl-L-homocysteine | C14 H20 N6 O5 S | 4 |
Structural origins for the product specificity of SET domain protein methyltransferases. Couture, J.F., Dirk, L.M., Brunzelle, J.S. et al. Proc Natl Acad Sci U S A (2008) 105:20659-20664. DOI 10.1073/pnas.0806712105 · PubMed
Other PDB entries of the same protein (UniProt Q9NQR1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3F9W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.