3FBI: Mediator submodule Med7N/31

Structure of the Mediator submodule Med7N/31. Determined by X-ray diffraction at 2.8 Å resolution. Released 16 Dec 2008.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 2,436
Mol. weight: 49.28 kDa
Released: 16 Dec 2008

Explore 3FBI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FBI contains 30 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	15-18	4
α-helix	19-23	5
α-helix	26-40	15
α-helix	62-66	5
α-helix	68-72	5
α-helix	75-77	3

Chain B: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	20-24	5
α-helix	25-35	11
α-helix	39-46	8
α-helix	50-52	3
α-helix	56-63	8
α-helix	64-68	5
α-helix	72-75	4
α-helix	80-94	15
α-helix	95-96	2
β-strand	97	1	1
α-helix	98	1
β-strand	103	1	1
α-helix	104-106	3

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	16-18	3
α-helix	19-23	5
α-helix	26-39	14
α-helix	63-66	4
α-helix	68-72	5

Chain D: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	19-24	6
α-helix	25-35	11
α-helix	39-46	8
α-helix	50-52	3
α-helix	55-63	9
α-helix	64-68	5
α-helix	72-75	4
α-helix	80-93	14
β-strand	97	1	2
β-strand	103	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mediator of RNA polymerase II transcription subunit 7	A, C	protein	84	Saccharomyces cerevisiae	Q08278 (AlphaFold model)
Mediator of RNA polymerase II transcription subunit 31	B, D	protein	130	Saccharomyces cerevisiae	P38633 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>3FBI_1 Mediator of RNA polymerase II transcription subunit 7 (chains A, C)
MASNDPGNEVSSLYPPPPPYVKFFTQSNLEKLPKYKEKKAASAKQTAPNNSNGGSEEEIT
CALDYLIPPPMPKNQQYRAFGSIW

Sequence of entity 2 (B, D), FASTA

>3FBI_2 Mediator of RNA polymerase II transcription subunit 31 (chains B, D)
GSHMSSTNGNAPATPSSDQNPLPTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNY
LKYLEYWCNPPYSQCIVYPNCLFILKLLNGFMESAIVNEDGLLEGLDELPKIIQLQGPQW
MNEMVERWAN

Primary citation

Identification, structure, and functional requirement of the Mediator submodule Med7N/31. Koschubs, T., Seizl, M., Lariviere, L. et al. EMBO J (2009) 28:69-80. DOI 10.1038/emboj.2008.254 · PubMed

Other PDB entries of the same protein (UniProt Q08278 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YKH 3.0 Å, Structure of the mediator MED7/MED21 (Med7/Srb7) subcomplex
8CEN 3.0 Å, Yeast RNA polymerase II transcription pre-initiation complex with core Mediator
3FBN 3.01 Å, Structure of the Mediator submodule Med7N/31
1YKE 3.3 Å, Structure of the mediator MED7/MED21 subcomplex
7UI9 3.3 Å, Core Mediator-PICearly (Copy A)
7UIO 3.3 Å, Mediator-PIC Early (Composite Model)
9PC8 3.4 Å, Core Mediator of PIC-Med-SWI/SNF
8CEO 3.6 Å, Yeast RNA polymerase II transcription pre-initiation complex with core Mediator and the…
7UIG 4.3 Å, Mediator-PIC Early (Mediator A)
7UIF 4.6 Å, Mediator-PIC Early (Core B)
5OQM 5.8 Å, Structure of yeast transcription pre-initiation complex with tfiih and core mediator
5SVA 15.3 Å, Mediator-RNA Polymerase II Pre-Initiation Complex

Browse structure collections

About this viewer

MolViewer shows 3FBI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.