Complex of UNG2 and a fragment-based designed inhibitor. Determined by X-ray diffraction at 1.84 Å resolution. Released 28 Apr 2009.
Explore 3FCF in 3D Show helices and sheets RCSB PDB PDBe
3FCF contains 14 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 87-93 | 7 | |
| α-helix | 94-96 | 3 | |
| α-helix | 100-115 | 16 | |
| β-strand | 118-119 | 2 | 1 |
| α-helix | 122-124 | 3 | |
| α-helix | 127-129 | 3 | |
| α-helix | 134-136 | 3 | |
| β-strand | 139-143 | 5 | 2 |
| α-helix | 165-167 | 3 | |
| α-helix | 168-180 | 13 | |
| α-helix | 193-196 | 4 | |
| β-strand | 200-204 | 5 | 2 |
| β-strand | 209-210 | 2 | 1 |
| α-helix | 222-236 | 15 | |
| β-strand | 241-245 | 5 | 2 |
| α-helix | 247-252 | 6 | |
| β-strand | 262-266 | 5 | 2 |
| α-helix | 274-276 | 3 | |
| α-helix | 283-293 | 11 | |
| α-helix | 297-299 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Uracil-DNA glycosylase | A | protein | 223 | Homo sapiens | P13051 (AlphaFold model) |
>3FCF_1 Uracil-DNA glycosylase (chains A) MEFFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVI LGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVL LLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRH HVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
| ID | Name | Formula | Copies |
|---|---|---|---|
| SCN | Thiocyanate ion | C N S | 2 |
| FCF | 3-[(1E,7E)-8-(2,6-dioxo-1,2,3,6-tetrahydropyrimidin-4-yl)-3,6-dioxa-2,7-diazaoc… | C15 H14 N4 O6 | 1 |
Impact of linker strain and flexibility in the design of a fragment-based inhibitor. Chung, S., Parker, J.B., Bianchet, M. et al. Nat Chem Biol (2009) 5:407-413. DOI 10.1038/nchembio.163 · PubMed
Other PDB entries of the same protein (UniProt P13051 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3FCF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.