Structure of human Uracil DNA Glycosylase (UDG) bound to Aurintricarboxylic acid (ATA). Determined by X-ray diffraction at 1.8 Å resolution. Released 3 Mar 2021.
Explore 6VBA in 3D Show helices and sheets RCSB PDB PDBe
6VBA contains 15 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 87-93 | 7 | |
| α-helix | 94-96 | 3 | |
| α-helix | 100-115 | 16 | |
| β-strand | 118-119 | 2 | 1 |
| α-helix | 122-124 | 3 | |
| α-helix | 127-129 | 3 | |
| α-helix | 134-136 | 3 | |
| β-strand | 139-143 | 5 | 2 |
| α-helix | 146-147 | 2 | |
| α-helix | 165-167 | 3 | |
| α-helix | 168-180 | 13 | |
| α-helix | 193-196 | 4 | |
| β-strand | 200-204 | 5 | 2 |
| β-strand | 209-210 | 2 | 1 |
| α-helix | 222-236 | 15 | |
| β-strand | 241-245 | 5 | 2 |
| α-helix | 247-252 | 6 | |
| β-strand | 262-266 | 5 | 2 |
| α-helix | 274-276 | 3 | |
| α-helix | 283-293 | 11 | |
| α-helix | 297-299 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Uracil-DNA glycosylase | A | protein | 223 | Homo sapiens | P13051 (AlphaFold model) |
>6VBA_1 Uracil-DNA glycosylase (chains A) MEFFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVI LGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVL LLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRH HVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
| ID | Name | Formula | Copies |
|---|---|---|---|
| QU4 | 3,3'-[(3-carboxy-4-oxocyclohexa-2,5-dien-1-ylidene)methylene]bis(6-hydroxybenzo… | C22 H14 O9 | 1 |
An effective human uracil-DNA glycosylase inhibitor targets the open pre-catalytic active site conformation. Nguyen, M.T., Moiani, D., Ahmed, Z. et al. Prog Biophys Mol Biol (2021) 163:143-159. DOI 10.1016/j.pbiomolbio.2021.02.004 · PubMed
Other PDB entries of the same protein (UniProt P13051 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6VBA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.