3FEA: HdmX

Crystal Structure of HdmX bound to the p53-peptidomimetic Ac-Phe-Met-Aib-Pmp-6-Cl-Trp-Glu-Ac3c-Leu-NH2 at 1.33A. Determined by X-ray diffraction at 1.33 Å resolution. Released 27 Jan 2009.

Method: X-ray diffraction
Resolution: 1.33 Å
Organism: Homo sapiens
Chains: 3
Atoms: 930
Mol. weight: 13.69 kDa
Released: 27 Jan 2009

Explore 3FEA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FEA contains 6 α-helices and 7 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	27	1	1
β-strand	28-29	2	2
α-helix	31-39	9
β-strand	47	1	1
α-helix	49-62	14
β-strand	66-67	2	3
β-strand	70-75	6	3
α-helix	80-85	6
β-strand	89-91	3	3
α-helix	96-105	10
β-strand	106-107	2	2

Chain L: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-7	5

Chain M: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mdm4 protein	A	protein	100	Homo sapiens	O15151 (AlphaFold model)
p53-peptidomimetic Ac-Phe-Met-Aib-Pmp-6-Cl-Trp-Glu-Ac3c-Leu-NH2	L, M	protein	10

Sequence of entity 1 (A), FASTA

>3FEA_1 Mdm4 protein (chains A)
GPDSASRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQ
HMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLAT

Sequence of entity 2 (L, M), FASTA

>3FEA_2 p53-peptidomimetic Ac-Phe-Met-Aib-Pmp-6-Cl-Trp-Glu-Ac3c-Leu-NH2 (chains L, M)
XFMAFWEXLX

Primary citation

Crystal Structures of Human MdmX (HdmX) in Complex with p53 Peptide Analogues Reveal Surprising Conformational Changes. Kallen, J., Goepfert, A., Blechschmidt, A. et al. J Biol Chem (2009) 284:8812-8821. DOI 10.1074/jbc.M809096200 · PubMed

Other PDB entries of the same protein (UniProt O15151 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Q9Y 1.2 Å, HDMX (14-111; C17S) COMPLEXED WITH COMPOUND 16 AT 1.20A; Structural states of Hdm2 and…
3FE7 1.35 Å, Crystal Structure of HdmX bound to the p53-peptidomimetic…
3FDO 1.4 Å, Structure of human MDMX in complex with high affinity peptide
3LBJ 1.5 Å, Structure of human MDMX protein in complex with a small molecule inhibitor
4RXZ 1.55 Å, Crystal Structure of MDMX phosporylated Tyr99 in complex with a 12-mer peptide
6Q9W 1.55 Å, X-ray structure of compound 15 bound to HdmX: Structural states of Hdm2 and HdmX: X-ray…
3EQY 1.63 Å, Crystal structure of human MDMX in complex with a 12-mer peptide inhibitor
7C3Y 1.63 Å, Crystal structure of the N-terminal domain of human MdmX protein in complex with Nutlin3a
7C44 1.65 Å, Crystal structure of the p53-binding domain of human MdmX protein in complex with Nutlin3a
8HDG 1.73 Å, Small peptide enhances the binding of nutline-3a to MdmX
3JZP 1.74 Å, Human MDMX liganded with a 12mer peptide inhibitor (pDI6W)
3JZO 1.8 Å, Human MDMX liganded with a 12mer peptide (pDI)

Browse structure collections

About this viewer

MolViewer shows 3FEA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.