3LBJ: Human MDMX protein

Name: PDB 3LBJ: Structure of human MDMX protein in complex with a small molecule inhibitor
Published: 2010-03-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cell cycle

Structure of human MDMX protein in complex with a small molecule inhibitor. Determined by X-ray diffraction at 1.5 Å resolution. Released 16 Mar 2010.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 864
Mol. weight: 11.65 kDa
Ligands: WW8
Released: 16 Mar 2010

Explore 3LBJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LBJ contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	27	1	1
β-strand	29	1	2
α-helix	31-39	9
β-strand	47	1	1
α-helix	49-62	14
β-strand	66-67	2	3
β-strand	70-75	6	3
α-helix	80-85	6
β-strand	89-91	3	3
β-strand	94	1	3
α-helix	97-105	9
β-strand	106	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein Mdm4	E	protein	90	Homo sapiens	O15151 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>3LBJ_1 Protein Mdm4 (chains E)
MQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLL
GELLGRQSFSVKDPSPLYDMLRKNLVTLAT

Ligands and cofactors

ID	Name	Formula	Copies
WW8	N-[(3S)-1-({6-chloro-3-[1-(4-chlorobenzyl)-4-phenyl-1H-imidazol-5-yl]-1H-indol-…	C35 H38 Cl2 N6 O	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structures of low molecular weight inhibitors bound to MDMX and MDM2 reveal new approaches for p53-MDMX/MDM2 antagonist drug discovery. Popowicz, G.M., Czarna, A., Wolf, S. et al. Cell Cycle (2010) 9:1104-1111. DOI 10.4161/cc.9.6.10956 · PubMed

Other PDB entries of the same protein (UniProt O15151 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Q9Y 1.2 Å, HDMX (14-111; C17S) COMPLEXED WITH COMPOUND 16 AT 1.20A; Structural states of Hdm2 and…
3FEA 1.33 Å, Crystal Structure of HdmX bound to the p53-peptidomimetic…
3FE7 1.35 Å, Crystal Structure of HdmX bound to the p53-peptidomimetic…
3FDO 1.4 Å, Structure of human MDMX in complex with high affinity peptide
4RXZ 1.55 Å, Crystal Structure of MDMX phosporylated Tyr99 in complex with a 12-mer peptide
6Q9W 1.55 Å, X-ray structure of compound 15 bound to HdmX: Structural states of Hdm2 and HdmX: X-ray…
3EQY 1.63 Å, Crystal structure of human MDMX in complex with a 12-mer peptide inhibitor
7C3Y 1.63 Å, Crystal structure of the N-terminal domain of human MdmX protein in complex with Nutlin3a
7C44 1.65 Å, Crystal structure of the p53-binding domain of human MdmX protein in complex with Nutlin3a
8HDG 1.73 Å, Small peptide enhances the binding of nutline-3a to MdmX
3JZP 1.74 Å, Human MDMX liganded with a 12mer peptide inhibitor (pDI6W)
3JZO 1.8 Å, Human MDMX liganded with a 12mer peptide (pDI)

Browse structure collections

About this viewer

MolViewer shows 3LBJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.