Crystal structure of the EH 1 domain from human intersectin-1 protein. Northeast Structural Genomics Consortium target HR3646e. Determined by X-ray diffraction at 1.45 Å resolution. Released 30 Dec 2008.
Explore 3FIA in 3D Show helices and sheets RCSB PDB PDBe
3FIA contains 8 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-18 | 3 | |
| α-helix | 19-31 | 13 | |
| β-strand | 35 | 1 | 1 |
| β-strand | 38 | 1 | 1 |
| β-strand | 39-40 | 2 | 2 |
| α-helix | 41-48 | 8 | |
| α-helix | 49-51 | 3 | |
| α-helix | 55-65 | 11 | |
| β-strand | 72-73 | 2 | 2 |
| α-helix | 75-89 | 15 | |
| α-helix | 92-95 | 4 | |
| α-helix | 100-102 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Intersectin-1 | A | protein | 121 | Homo sapiens | Q15811 (AlphaFold model) |
>3FIA_1 Intersectin-1 (chains A) MGHHHHHHSHVAQFPTPFGGSLDTWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQ SGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAIS S
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (SO4) are not listed.
Crystal structure of the EH 1 domain from human intersectin-1 protein. Vorobiev, S.M., Chen, Y., Seetharaman, J. et al. To be published.
Other PDB entries of the same protein (UniProt Q15811 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3FIA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.