Recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411) bound to calcium at PH 6.0: a further refinement of PDB entry 1FIB, and differs from 1FIB by the modelling of a cis peptide bond between residues K338 and C339. Determined by X-ray diffraction at 2.1 Å resolution. Released 17 Sept 1997.
Explore 3FIB in 3D Show helices and sheets RCSB PDB PDBe
3FIB contains 9 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 145-150 | 6 | 1 |
| α-helix | 153-158 | 6 | |
| β-strand | 165-169 | 5 | 1 |
| β-strand | 178-184 | 7 | 1 |
| β-strand | 190-197 | 8 | 1 |
| α-helix | 208-213 | 6 | |
| β-strand | 215-216 | 2 | 1 |
| β-strand | 226-227 | 2 | 1 |
| α-helix | 230-238 | 9 | |
| α-helix | 239-241 | 3 | |
| β-strand | 244-251 | 8 | 1 |
| β-strand | 257-263 | 7 | 1 |
| β-strand | 266-267 | 2 | 2 |
| α-helix | 270-272 | 3 | |
| β-strand | 276-277 | 2 | 2 |
| β-strand | 280-283 | 4 | 1 |
| α-helix | 289-291 | 3 | |
| α-helix | 301-305 | 5 | |
| α-helix | 310-312 | 3 | |
| β-strand | 313 | 1 | 3 |
| β-strand | 314 | 1 | 4 |
| β-strand | 317 | 1 | 4 |
| α-helix | 326-330 | 5 | |
| β-strand | 334 | 1 | 3 |
| β-strand | 342-343 | 2 | 5 |
| β-strand | 347 | 1 | 6 |
| β-strand | 353 | 1 | 7 |
| β-strand | 366 | 1 | 6 |
| β-strand | 368-369 | 2 | 5 |
| β-strand | 377 | 1 | 7 |
| β-strand | 381-388 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fibrinogen gamma chain residues | A | protein | 249 | Homo sapiens | P02679 (AlphaFold model) |
>3FIB_1 FIBRINOGEN GAMMA CHAIN RESIDUES (chains A) QIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVD FKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYA MFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFE GNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTT MKIIPFNRL
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
The primary fibrin polymerization pocket: three-dimensional structure of a 30-kDa C-terminal gamma chain fragment complexed with the peptide Gly-Pro-Arg-Pro. Pratt, K.P., Cote, H.C., Chung, D.W. et al. Proc Natl Acad Sci U S A (1997) 94:7176-7181. DOI 10.1073/pnas.94.14.7176 · PubMed
Other PDB entries of the same protein (UniProt P02679 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3FIB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.