3G33: CDK4/cyclin D3

Crystal structure of CDK4/cyclin D3. Determined by X-ray diffraction at 3.0 Å resolution. Released 10 Mar 2009.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 8,158
Mol. weight: 136.48 kDa
Released: 10 Mar 2009

Explore 3G33 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3G33 contains 61 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	11	1
β-strand	12-17	6	1
β-strand	25-29	5	1
β-strand	36-45	10	1
β-strand	49	1	2
β-strand	51	1	2
α-helix	56-71	16
β-strand	76	1	3
β-strand	79-85	7	1
β-strand	91-99	9	1
α-helix	100	1
β-strand	104	1	3
α-helix	105-110	6
α-helix	119-138	20
β-strand	151-153	3	3
β-strand	159-161	3	3
α-helix	177-180	4
α-helix	188-192	5
α-helix	200-211	12
α-helix	224-235	12
α-helix	237-239	3
α-helix	251-253	3
α-helix	259-261	3
α-helix	262-265	4
α-helix	271-280	10
α-helix	291-295	5

Chain B: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	24-34	11
α-helix	35-38	4
α-helix	54-70	17
α-helix	77-91	15
α-helix	96-98	3
α-helix	99-114	16
α-helix	118-120	3
α-helix	123-127	5
α-helix	134-147	14
α-helix	157-160	4
α-helix	161-166	6
α-helix	175-191	17
α-helix	193-195	3
α-helix	200-213	14
α-helix	222-233	12
α-helix	237-252	16

Chain C: 14 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	12-17	6	4
β-strand	25-29	5	4
β-strand	36-45	10	4
β-strand	49	1	5
β-strand	51	1	5
α-helix	56-71	16
β-strand	76	1	6
β-strand	79-85	7	4
β-strand	91-99	9	4
α-helix	100	1
β-strand	104	1	6
α-helix	105-110	6
α-helix	119-138	20
β-strand	151-153	3	6
β-strand	159-161	3	6
α-helix	167-176	10
α-helix	188-191	4
α-helix	200-211	12
α-helix	224-235	12
α-helix	237-239	3
α-helix	251-253	3
α-helix	259-261	3
α-helix	262-265	4
α-helix	271-280	10
α-helix	291-295	5

Chain D: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	24-34	11
α-helix	35-38	4
α-helix	54-70	17
α-helix	77-91	15
α-helix	96-98	3
α-helix	99-114	16
α-helix	118-120	3
α-helix	123-127	5
α-helix	134-147	14
α-helix	157-160	4
α-helix	161-166	6
α-helix	175-191	17
α-helix	193-195	3
α-helix	200-213	14
α-helix	223-233	11
α-helix	237-252	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell division protein kinase 4	A, C	protein	308	Homo sapiens	P11802 (AlphaFold model)
CCND3 protein	B, D	protein	306	Homo sapiens	P30281 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>3G33_1 Cell division protein kinase 4 (chains A, C)
GPLGSMATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVR
EVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAE
TIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVV
VTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPE
DDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYL
HKDEGNPE

Sequence of entity 2 (B, D), FASTA

>3G33_2 CCND3 protein (chains B, D)
MDYKDDDDKSPGGSMELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQ
CVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVC
MLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILH
RLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELT
ELLAGITGTEVDCLRACQEQIEAALRESLREAAQTSSSPAPKAPRGSSSQGPSQTSTPTD
VTAIHL

Primary citation

The structure of CDK4/cyclin D3 has implications for models of CDK activation. Takaki, T., Echalier, A., Brown, N.R. et al. Proc Natl Acad Sci U S A (2009) 106:4171-4176. DOI 10.1073/pnas.0809674106 · PubMed

Other PDB entries of the same protein (UniProt P11802 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CSK 2.25 Å, Crystal structure of CDK4 cyclin D1 in complex with atirmociclib
2W96 2.3 Å, Crystal Structure of CDK4 in complex with a D-type cyclin
6P8E 2.3 Å, Crystal structure of CDK4 in complex with CyclinD1 and P27
2W9Z 2.45 Å, Crystal Structure of CDK4 in complex with a D-type cyclin
7SJ3 2.51 Å, Structure of CDK4-Cyclin D3 bound to abemaciclib
2W99 2.8 Å, Crystal Structure of CDK4 in complex with a D-type cyclin
6P8G 2.8 Å, Crystal structure of CDK4 in complex with CyclinD1 and P27
2W9F 2.85 Å, Crystal Structure of CDK4 in complex with a D-type cyclin
6P8F 2.89 Å, Crystal structure of CDK4 in complex with CyclinD1 and P27
6P8H 3.19 Å, Crystal structure of CDK4 in complex with CyclinD1 and P21
5FWK 3.9 Å, Atomic cryoEM structure of Hsp90-Cdc37-Cdk4 complex
5FWP 7.2 Å, Atomic cryoEM structure of Hsp90-Cdc37-Cdk4 complex

Browse structure collections

About this viewer

MolViewer shows 3G33 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.