Crystal Structure of Human SIRT3 with ADPR bound to the AceCS2 peptide containing a thioacetyl lysine. Determined by X-ray diffraction at 2.1 Å resolution. Released 16 Jun 2009.
Explore 3GLT in 3D Show helices and sheets RCSB PDB PDBe
3GLT contains 21 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 125-133 | 9 | |
| β-strand | 140-144 | 5 | 1 |
| α-helix | 146-148 | 3 | |
| α-helix | 150-152 | 3 | |
| α-helix | 164-166 | 3 | |
| α-helix | 176-180 | 5 | |
| α-helix | 182-187 | 6 | |
| α-helix | 190-199 | 10 | |
| α-helix | 208-218 | 11 | |
| β-strand | 222-227 | 6 | 1 |
| α-helix | 233-236 | 4 | |
| α-helix | 241-243 | 3 | |
| β-strand | 244-246 | 3 | 1 |
| β-strand | 249-256 | 8 | 2 |
| β-strand | 262-264 | 3 | 2 |
| α-helix | 265-268 | 4 | |
| α-helix | 269-273 | 5 | |
| β-strand | 279 | 1 | 3 |
| α-helix | 285 | 1 | |
| β-strand | 286 | 1 | 3 |
| β-strand | 287-291 | 5 | 2 |
| α-helix | 292-293 | 2 | |
| α-helix | 297-299 | 3 | |
| α-helix | 300-304 | 5 | |
| α-helix | 305-311 | 7 | |
| β-strand | 314-318 | 5 | 1 |
| β-strand | 324-325 | 2 | 4 |
| α-helix | 328-333 | 6 | |
| β-strand | 340-344 | 5 | 1 |
| α-helix | 349-353 | 5 | |
| β-strand | 359-363 | 5 | 1 |
| α-helix | 366-377 | 12 | |
| α-helix | 380-392 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 643-644 | 2 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NAD-dependent deacetylase sirtuin-3, mitochondrial | A | protein | 285 | Homo sapiens | Q9NTG7 (AlphaFold model) |
| Acetyl-coenzyme A synthetase 2-like, mitochondrial | B | protein | 12 | Homo sapiens | Q9NUB1 (AlphaFold model) |
>3GLT_1 NAD-dependent deacetylase sirtuin-3, mitochondrial (chains A) SNASDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLP YPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLE RVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFF GEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWH PRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
>3GLT_2 Acetyl-coenzyme A synthetase 2-like, mitochondrial (chains B) TRSGKVMRRLLR
Water and common crystallization additives (SO4) are not listed.
Crystal Structures of Human SIRT3 Displaying Substrate-induced Conformational Changes. Jin, L., Wei, W., Jiang, Y. et al. J Biol Chem (2009) 284:24394-24405. DOI 10.1074/jbc.M109.014928 · PubMed
Other PDB entries of the same protein (UniProt Q9NTG7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3GLT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.