3GM1: Focal Adhesion Targeting (FAT) Domain of Pyk2
Crystal Structure of the Focal Adhesion Targeting (FAT) Domain of Pyk2 in Complex with Paxillin LD4 Motif-Derived Peptides. Determined by X-ray diffraction at 2.95 Å resolution. Released 5 May 2009.
- Method
- X-ray diffraction
- Resolution
- 2.95 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 2,528
- Mol. weight
- 39.13 kDa
- Released
- 5 May 2009
Explore 3GM1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3GM1 contains 13 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 879-895 | 17 | |
| α-helix | 904-925 | 22 | |
| α-helix | 935-962 | 28 | |
| α-helix | 969-1000 | 32 | |
Chain B: 5 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 879-897 | 19 | |
| α-helix | 906-925 | 20 | |
| α-helix | 928-930 | 3 | |
| α-helix | 935-962 | 28 | |
| α-helix | 969-1000 | 32 | |
Chain C: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 266-271 | 6 | |
Chain D: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 264-272 | 9 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 266-273 | 8 | |
Chain F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 266-272 | 7 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Protein tyrosine kinase 2 beta | A, B | protein | 153 | Homo sapiens | Q14289 (AlphaFold model) |
| Paxillin | C, D, E, F | protein | 13 | | P49023 (AlphaFold model) |
Sequence of entity 1 (A, B), FASTA
>3GM1_1 Protein tyrosine kinase 2 beta (chains A, B)
GSHMRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELAQLPPEGYVVVVKNVGLT
LRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQM
LTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
Sequence of entity 2 (C, D, E, F), FASTA
>3GM1_2 Paxillin (chains C, D, E, F)
ATRELDELMASLS
Primary citation
Crystal structures of free and ligand-bound focal adhesion targeting domain of Pyk2. Lulo, J., Yuzawa, S., Schlessinger, J. Biochem Biophys Res Commun (2009) 383:347-352. DOI 10.1016/j.bbrc.2009.04.011 · PubMed
Other PDB entries of the same protein (UniProt Q14289 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3CC6 1.6 Å, Crystal structure of kinase domain of protein tyrosine kinase 2 beta (PTK2B)
- 3FZS 1.75 Å, Crystal Structure of PYK2 complexed with BIRB796
- 4XEK 1.79 Å, Pyk2-FAT domain in complex with leupaxin LD4 motif
- 8XOX 1.9 Å, The Crystal Structure of FAK2 from Biortus.
- 3FZT 1.95 Å, Crystal structure of PYK2 complexed with PF-4618433
- 5TO8 1.98 Å, Selectivity switch between FAK and Pyk2: Macrocyclization of FAK inhibitors improves…
- 4H1M 1.99 Å, Crystal structure of PYK2 with the indole 10c
- 3H3C 2.0 Å, Crystal structure of PYK2 in complex with Sulfoximine-substituted…
- 4H1J 2.0 Å, Crystal structure of PYK2 with the pyrazole 13a
- 8YGX 2.0 Å, Structure of the PYK2 from Biortus.
- 4XEV 2.01 Å, Fusion of Pyk2-FAT domain with Leupaxin LD1 motif, complexed with Leupaxin LD4 peptide
- 3FZP 2.1 Å, Crystal structure of PYK2 complexed with ATPgS
Browse structure collections
About this viewer
MolViewer shows 3GM1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.