Crystal structure of Cell Inhibiting Factor (Cif) from Burkholderia pseudomallei (CifBp). Determined by X-ray diffraction at 2.1 Å resolution. Released 2 Jun 2009.
Explore 3GQM in 3D Show helices and sheets RCSB PDB PDBe
3GQM contains 32 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 15-28 | 14 | |
| α-helix | 29-31 | 3 | |
| α-helix | 33-39 | 7 | |
| α-helix | 48-50 | 3 | |
| α-helix | 53-66 | 14 | |
| α-helix | 70-77 | 8 | |
| α-helix | 90-102 | 13 | |
| α-helix | 114-115 | 2 | |
| β-strand | 116 | 1 | 1 |
| α-helix | 121-125 | 5 | |
| β-strand | 133-140 | 8 | 1 |
| β-strand | 145-151 | 7 | 1 |
| β-strand | 161 | 1 | 2 |
| β-strand | 162-164 | 3 | 1 |
| β-strand | 167 | 1 | 3 |
| β-strand | 176 | 1 | 3 |
| α-helix | 178-185 | 8 | |
| β-strand | 190 | 1 | 2 |
| α-helix | 192-198 | 7 | |
| α-helix | 201-205 | 5 | |
| α-helix | 208-219 | 12 | |
| α-helix | 225-227 | 3 | |
| α-helix | 230-232 | 3 | |
| β-strand | 239-246 | 8 | 1 |
| α-helix | 248-259 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 15-29 | 15 | |
| α-helix | 33-39 | 7 | |
| α-helix | 48-50 | 3 | |
| α-helix | 53-66 | 14 | |
| α-helix | 70-76 | 7 | |
| α-helix | 85-86 | 2 | |
| α-helix | 90-102 | 13 | |
| α-helix | 114-115 | 2 | |
| β-strand | 116 | 1 | 4 |
| α-helix | 121-126 | 6 | |
| β-strand | 133-140 | 8 | 4 |
| β-strand | 145-151 | 7 | 4 |
| β-strand | 161 | 1 | 5 |
| β-strand | 162-164 | 3 | 4 |
| β-strand | 167 | 1 | 6 |
| β-strand | 176 | 1 | 6 |
| α-helix | 178-185 | 8 | |
| β-strand | 190 | 1 | 5 |
| α-helix | 192-198 | 7 | |
| α-helix | 201-203 | 3 | |
| α-helix | 208-219 | 12 | |
| α-helix | 225-227 | 3 | |
| α-helix | 230-232 | 3 | |
| β-strand | 239-246 | 8 | 4 |
| α-helix | 248-259 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cell Inhibiting Factor (CifBp) | A, B | protein | 276 | Burkholderia pseudomallei | Q63KH5 (AlphaFold model) |
>3GQM_1 Cell Inhibiting Factor (CifBp) (chains A, B) MGSSHHHHHHSSGLMITPIISSNLGLKHRVTLRKATLASLMQSLSGESSNRVMWNDRYDT LLIARDPREIKNAIEKSVTDFGGLENYKELTGGADPFALMTPVCGLSANNIFKLMTEKDV PIDPTSIEYLENTSFAEHVNTLDSHKNYVVIVNDGRLGHKFLIDLPALTQGPRTAYIIQS DLGGGALPAVRVEDWISRRGSDPVSLDELNQLLSKDFSKMPDDVQTRLLASILQIDKDPH KVDIKKLHLDGKLRFASHEYDFRQFQRNAQYVAGLG
Crystal structures of Cif from bacterial pathogens Photorhabdus luminescens and Burkholderia pseudomallei. Crow, A., Race, P.R., Jubelin, G. et al. PLoS One (2009) 4:e5582-e5582. DOI 10.1371/journal.pone.0005582 · PubMed
Other PDB entries of the same protein (UniProt Q63KH5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3GQM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.