3GS2: Ring1B C-terminal domain/Cbx7 Cbox Complex

Ring1B C-terminal domain/Cbx7 Cbox Complex. Determined by X-ray diffraction at 1.7 Å resolution. Released 25 Aug 2010.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,415
Mol. weight: 32.16 kDa
Ligands: ZN
Released: 25 Aug 2010

Explore 3GS2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GS2 contains 10 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	225-232	8	1
β-strand	246-251	6	1
β-strand	255	1	2
α-helix	256-277	22
β-strand	291-296	6	1
β-strand	302-304	3	1
α-helix	305-306	2
β-strand	310	1	2
α-helix	311-314	4
α-helix	315-319	5
β-strand	325-331	7	1

Chains B and D: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	221-227	7	1
β-strand	230-237	8	1
α-helix	245-246	2

Chain C: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	226-232	7	3
β-strand	246-250	5	3
β-strand	255	1	4
α-helix	256-277	22
β-strand	291-297	7	3
β-strand	301-304	4	3
α-helix	305-306	2
β-strand	310	1	4
α-helix	311-314	4
α-helix	315-319	5
β-strand	325-331	7	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase RING2	A, C	protein	111	Homo sapiens	Q99496 (AlphaFold model)
Chromobox protein homolog 7	B, D	protein	30	Homo sapiens	O95931 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>3GS2_1 E3 ubiquitin-protein ligase RING2 (chains A, C)
ASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMN
LDTASEKQYTIYIATASGQFTVLDGSFSLELVSEKYWKVNKPMELYYAPTK

Sequence of entity 2 (B, D), FASTA

>3GS2_2 Chromobox protein homolog 7 (chains B, D)
EVTVTDITANSITVTFREAQAAEGFFRDRS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Polycomb Group Targeting through Different Binding Partners of RING1B C-Terminal Domain. Wang, R., Taylor, A.B., Leal, B.Z. et al. Structure (2010) 18:966-975. DOI 10.1016/j.str.2010.04.013 · PubMed

Other PDB entries of the same protein (UniProt Q99496 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IXS 1.7 Å, Ring1B C-terminal domain/RYBP C-terminal domain Complex
6WI7 1.7 Å, RING1B-BMI1 fusion in closed conformation
3H8H 2.0 Å, Structure of the C-terminal domain of human RNF2/RING1B;
4S3O 2.0 Å, PCGF5-RING1B-UbcH5c complex
2H0D 2.5 Å, Structure of a Bmi-1-Ring1B Polycomb group ubiquitin ligase complex
3RPG 2.65 Å, Bmi1/Ring1b-UbcH5c complex structure
28OE 2.74 Å, Human PRC1.4 in complex with native UBCH5C bound to a H3Kc27me3 mononucleosome
9DBY 2.8 Å, ncPRC1RYBP bound to singly modified H2AK119Ub nucleosome
9V9Q 2.8 Å, Cryo-EM structure of the cPRC1-UbcH5c E3-E2 complex bound to the H2BK120ub-modified…
8PP7 2.91 Å, human RYBP-PRC1 bound to mononucleosome
9DGG 2.98 Å, ncPRC1RYBP bound to unmodified nucleosome
9V6S 3.0 Å, Cryo-EM structure of a single cPRC1 complex engaged on one face of an endogenous 147-bp…

Browse structure collections

About this viewer

MolViewer shows 3GS2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.