Crystal structure of IpgC from Shigella flexneri. Determined by X-ray diffraction at 2.15 Å resolution. Released 16 Jun 2009.
Explore 3GYZ in 3D Show helices and sheets RCSB PDB PDBe
3GYZ contains 18 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-20 | 11 | |
| α-helix | 26-28 | 3 | |
| α-helix | 33-48 | 16 | |
| α-helix | 52-65 | 14 | |
| α-helix | 70-82 | 13 | |
| α-helix | 86-99 | 14 | |
| α-helix | 105-116 | 12 | |
| α-helix | 120-133 | 14 | |
| α-helix | 137-150 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-21 | 11 | |
| α-helix | 25-28 | 4 | |
| α-helix | 33-48 | 16 | |
| α-helix | 52-65 | 14 | |
| α-helix | 70-82 | 13 | |
| α-helix | 86-99 | 14 | |
| α-helix | 105-116 | 12 | |
| α-helix | 120-133 | 14 | |
| α-helix | 137-150 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chaperone protein ipgC | A, B | protein | 151 | Shigella flexneri | P0A2U4 (AlphaFold model) |
>3GYZ_1 Chaperone protein ipgC (chains A, B) GSLNITENESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFR FLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAP LKAKECFELVIQHSNDEKLKIKAQSYLDAIQ
IpaB-IpgC interaction defines binding motif for type III secretion translocator. Lunelli, M., Lokareddy, R.K., Zychlinsky, A. et al. Proc Natl Acad Sci U S A (2009) 106:9661-9666. DOI 10.1073/pnas.0812900106 · PubMed
Other PDB entries of the same protein (UniProt P0A2U4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3GYZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.