3H0T: Hepcidin-Fab complex

Hepcidin-Fab complex. Determined by X-ray diffraction at 1.89 Å resolution. Released 23 Jun 2009.

Method: X-ray diffraction
Resolution: 1.89 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,821
Mol. weight: 51.44 kDa
Released: 23 Jun 2009

Explore 3H0T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3H0T contains 16 α-helices and 52 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	9-12	4	2
β-strand	18-24	7	1
α-helix	29-31	3
β-strand	32	1	3
β-strand	35-39	5	2
β-strand	46-49	4	2
β-strand	50	1	4
α-helix	51-53	3
β-strand	54	1	4
β-strand	63-68	6	1
β-strand	73-78	6	1
α-helix	83-85	3
β-strand	87-94	8	2
β-strand	99-101	3	2
β-strand	105-109	5	2
β-strand	115	1	5
α-helix	116-117	2
β-strand	118-122	5	6
α-helix	123-125	3
α-helix	126-130	5
β-strand	134-143	10	6
β-strand	144	1	5
β-strand	149-154	6	7
β-strand	157-159	3	7
β-strand	163-165	3	6
α-helix	166-168	3
β-strand	169-170	2	6
β-strand	176-184	9	6
α-helix	186-190	5
β-strand	195-201	7	7
β-strand	204-210	7	7

Chain B: 8 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	8
β-strand	11-12	2	9
β-strand	18-25	8	8
β-strand	35-42	8	10
β-strand	46-55	10	10
β-strand	59-63	5	10
α-helix	65-68	4
β-strand	71-72	2	8
β-strand	75-76	2	8
β-strand	81-86	6	8
α-helix	91-93	3
β-strand	95-103	9	10
β-strand	108-112	5	10
β-strand	116-118	3	10
β-strand	119-120	2	9
β-strand	126	1	11
α-helix	127-128	2
β-strand	129-133	5	12
α-helix	137-139	3
β-strand	140-141	2	12
β-strand	144-154	11	12
β-strand	155	1	11
β-strand	160-163	4	13
α-helix	164-166	3
β-strand	168	1	13
β-strand	173-174	2	12
α-helix	175-177	3
β-strand	178-179	2	12
β-strand	185-194	10	12
α-helix	195-197	3
β-strand	204-209	6	13
α-helix	210-212	3
β-strand	214-219	6	13

Chain C: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	14
β-strand	19	1	3
β-strand	20-23	4	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab fragment, Light chain	A	protein	216	Homo sapiens
Fab fragment, Heavy chain	B	protein	237	Homo sapiens
Hepcidin	C	protein	25	Homo sapiens	P81172 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3H0T_1 Fab fragment, Light chain (chains A)
NFMLTQPHSVSESPGKTVTISCTRSSGSIASYYVQWYQQRPGSSPTTVIYEDSQRPSGVP
DRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNVVFGGGTKLTVLGQPKAAPSVT
LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASS
YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Sequence of entity 2 (B), FASTA

>3H0T_2 Fab fragment, Heavy chain (chains B)
QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRSKWF
NDYAVSVQSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARGIVFSYAMDVWGQGTTVTV
SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCAADEVDHHHHHH

Sequence of entity 3 (C), FASTA

>3H0T_3 Hepcidin (chains C)
DTHFPICIFCCGCCHRSKCGMCCKT

Primary citation

Hepcidin revisited, disulfide connectivity, dynamics, and structure. Jordan, J.B., Poppe, L., Haniu, M. et al. J Biol Chem (2009) 284:24155-24167. DOI 10.1074/jbc.M109.017764 · PubMed

Other PDB entries of the same protein (UniProt P81172 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QAE 2.1 Å, Crystal structure of an engineered lipocalin (Anticalin) in complex with human hepcidin
6WBV 2.5 Å, Structure of human ferroportin bound to hepcidin and cobalt in lipid nanodisc
1M4E Solution Structure of Hepcidin-20
1M4F Solution Structure of Hepcidin-25
2KEF Solution NMR structures of human hepcidin at 325K

Browse structure collections

About this viewer

MolViewer shows 3H0T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.