3HHC: Interleukin-28B

Interferon-lambda is functionally an interferon but structurally related to the IL-10 family. Determined by X-ray diffraction at 2.8 Å resolution. Released 21 Jul 2009.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,506
Mol. weight: 91.4 kDa
Released: 21 Jul 2009

Explore 3HHC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HHC contains 40 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	7-9	3
α-helix	14-32	19
β-strand	38	1	1
α-helix	49-51	3
α-helix	54-56	3
α-helix	57-78	22
α-helix	80-101	22
α-helix	117-126	10
α-helix	128-130	3
α-helix	134-143	10
α-helix	145-147	3
α-helix	148-152	5
α-helix	153-157	5
α-helix	159-161	3

Chain B: 11 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	7-9	3
α-helix	14-31	18
β-strand	38	1	2
α-helix	54-56	3
α-helix	57-78	22
α-helix	80-101	22
α-helix	113-123	11
α-helix	128-131	4
α-helix	134-143	10
α-helix	145-147	3
α-helix	148-152	5
α-helix	153-158	6

Chain C: 10 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	6-8	3
α-helix	14-31	18
β-strand	33	1	1
α-helix	49-51	3
α-helix	57-78	22
α-helix	80-102	23
α-helix	119-126	8
α-helix	134-147	14
α-helix	148-152	5
α-helix	153-157	5
α-helix	159-161	3

Chain D: 6 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	17-31	15
β-strand	33	1	2
α-helix	61-76	16
α-helix	82-85	4
α-helix	100-102	3
α-helix	134-143	10
α-helix	145-149	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-28B	A, B, C, D	protein	196	Homo sapiens	Q8IZI9 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3HHC_1 Interleukin-28B (chains A, B, C, D)
MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDAL
EESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLD
QPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFR
LLTRDLNCVASGDLCV

Primary citation

Interferon-{lambda} Is Functionally an Interferon but Structurally Related to the Interleukin-10 Family. Gad, H.H., Dellgren, C., Hamming, O.J. et al. J Biol Chem (2009) 284:20869-20875. DOI 10.1074/jbc.M109.002923 · PubMed

Other PDB entries of the same protein (UniProt Q8IZI9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5T5W 2.85 Å, Structure of an affinity matured lambda-IFN/IFN-lambdaR1/IL-10Rbeta receptor complex
9BPV 3.0 Å, Structure of the IFN-lambda3/IFN-lambdaR1/IL-10Rbeta receptor complex with an engineered…

Browse structure collections

About this viewer

MolViewer shows 3HHC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.