3HKF: Murine unglycosylated IgG Fc fragment

Murine unglycosylated IgG Fc fragment. Determined by X-ray diffraction at 2.5 Å resolution. Released 10 Nov 2009.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,711
Mol. weight: 24.46 kDa
Ligands: MG
Released: 10 Nov 2009

Explore 3HKF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HKF contains 8 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	243-246	4	1
α-helix	247-249	3
α-helix	250-254	5
β-strand	261-269	9	1
β-strand	277	1	2
β-strand	280-282	3	3
β-strand	286-287	2	3
β-strand	291-292	2	1
β-strand	296-297	2	1
β-strand	303-310	8	1
α-helix	313-317	5
β-strand	322-326	5	3
β-strand	327	1	2
β-strand	335-339	5	3
β-strand	347	1	4
α-helix	348-349	2
β-strand	350-354	5	5
α-helix	358-360	3
β-strand	366-375	10	5
β-strand	376	1	4
β-strand	381-386	6	6
β-strand	389	1	6
β-strand	394-396	3	5
α-helix	397-399	3
β-strand	400-401	2	5
β-strand	407-415	9	5
α-helix	418-420	3
β-strand	426-431	6	6
α-helix	436-438	3
β-strand	439-444	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Igh protein	A	protein	214	Mus musculus	Q99LC4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3HKF_1 Igh protein (chains A)
MEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREE
QFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPP
KEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQK
SNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGKE

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Structure of the murine unglycosylated IgG1 Fc fragment. Feige, M.J., Nath, S., Catharino, S.R. et al. J Mol Biol (2009) 391:599-608. DOI 10.1016/j.jmb.2009.06.048 · PubMed

Other PDB entries of the same protein (UniProt Q99LC4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6C5K 1.75 Å, S25-23 Fab in complex with Chlamydiaceae LPS (Crystal form 2)
6C5I 1.89 Å, Unliganded S25-5 Fab
6C5H 1.99 Å, S25-5 Fab in complex with Chlamydiaceae-specific LPS antigen
6C5J 2.29 Å, S25-23 Fab in complex with Chlamydiaceae LPS (Crystal form 1)
1GIG 2.3 Å, Refined three-dimensional structure of the FAB fragment of a murine IgG1, lambda antibody
1JHK 2.51 Å, Crystal structure of the anti-estradiol antibody 57-2
2A1W 2.7 Å, Anti-cocaine antibody 7.5.21, crystal form I
5MP3 2.75 Å, Crystal structure of DC8E8 Fab in the complex with a 30-mer tau peptide at pH 6.5
4Q0X 2.9 Å, Crystal structure of non-neutralizing antibody in complex with Epitope II of HCV E2
1JNL 3.0 Å, Crystal Structure of Fab-Estradiol Complexes
1JNN 3.2 Å, Crystal Structure of Fab-Estradiol Complexes
1AFV 3.7 Å, HIV-1 capsid protein (P24) complex with FAB25.3

Browse structure collections

About this viewer

MolViewer shows 3HKF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.