3HQL: Speckle-type POZ protein

Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of BTB-Cul3 Ubiquitin Ligases:SPOPMATHx-PucSBC1_pep2. Determined by X-ray diffraction at 1.66 Å resolution. Released 20 Oct 2009.

Method: X-ray diffraction
Resolution: 1.66 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,491
Mol. weight: 36.45 kDa
Released: 20 Oct 2009

Explore 3HQL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HQL contains 12 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	30-38	9	1
α-helix	41-43	3
β-strand	52-53	2	2
α-helix	54-56	3
β-strand	57	1	2
β-strand	66-72	7	2
α-helix	78-80	3
β-strand	83-92	10	2
β-strand	98-107	10	1
β-strand	113-118	6	1
β-strand	123-125	3	1
β-strand	130-138	9	2
α-helix	139-142	4
α-helix	145-147	3
α-helix	151-153	3
β-strand	155-163	9	1

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	99	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Speckle-type POZ protein	A, B	protein	145	Homo sapiens	O43791 (AlphaFold model)
Puckered	C, D	protein	16		Q9VHV8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3HQL_1 Speckle-type POZ protein (chains A, B)
GSGGSGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESK
DYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRGF
LLDEANGLLPDDKLTLFCEVSVVQD

Sequence of entity 2 (C, D), FASTA

>3HQL_2 Puckered (chains C, D)
ENLACDEVTSTTSSST

Primary citation

Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases. Zhuang, M., Calabrese, M.F., Liu, J. et al. Mol Cell (2009) 36:39-50. DOI 10.1016/j.molcel.2009.09.022 · PubMed

Other PDB entries of the same protein (UniProt O43791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IVV 1.25 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
7LIN 1.44 Å, X-ray structure of SPOP MATH domain (D140G) in complex with a 53BP1 peptide
7D3D 1.45 Å, Crystal structure of SPOP bound with a peptide
9HFV 1.45 Å, MyD88 peptide_2 bound to SPOP MATH domain
7LIP 1.48 Å, X-ray structure of SPOP MATH domain (D140G)
4HS2 1.53 Å, Crystal Structure of the Human SPOP C-terminal Domain
3HQM 1.74 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
3IVB 1.75 Å, Structures of SPOP-Substrate Complexes: Insights into Architectures of BTB-Cul3…
6I5P 1.81 Å, Co-crystal structure of human SPOP MATH domain (E47K) and human BRD3 fragment
6I68 1.85 Å, Co-crystal structure of human SPOP MATH domain (M117V) and human BRD3 fragment
6I41 1.9 Å, Co-crystal structure of human SPOP MATH domain (wild-type) and human BRD3 fragment
9HGG 1.9 Å, SETD2 peptide bound to SPOP MATH domain

Browse structure collections

About this viewer

MolViewer shows 3HQL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.