3HU6: Speckle-type POZ protein

Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of BTB-Cul3 Ubiquitin Ligases: SPOPMATHx/BTB/3-box-PucSBC1. Determined by X-ray diffraction at 2.7 Å resolution. Released 20 Oct 2009.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,690
Mol. weight: 71.96 kDa
Released: 20 Oct 2009

Explore 3HU6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HU6 contains 27 α-helices and 30 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	28-39	12	1
α-helix	41-43	3
β-strand	52-53	2	2
β-strand	66-72	7	2
β-strand	84-92	9	2
β-strand	98-100	3	3
β-strand	101-107	7	1
β-strand	113-118	6	1
β-strand	123-125	3	3
β-strand	130-137	8	2
α-helix	139-143	5
α-helix	151-153	3
β-strand	154-165	12	1
α-helix	186-196	11
β-strand	202-206	5	4
β-strand	209-213	5	4
α-helix	215-221	7
α-helix	223-230	8
β-strand	240-243	4	4
α-helix	248-260	13
α-helix	266-269	4
α-helix	270-279	10
α-helix	283-294	12
α-helix	302-311	10
α-helix	315-326	12

Chain B: 15 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	28-39	12	1
β-strand	48	1	5
β-strand	50	1	5
β-strand	52-53	2	6
β-strand	57	1	6
β-strand	66-72	7	6
α-helix	78-80	3
β-strand	83-92	10	6
β-strand	98-107	10	1
β-strand	113-118	6	1
α-helix	122	1
β-strand	123-125	3	1
β-strand	130-138	9	6
α-helix	139-143	5
α-helix	145-147	3
α-helix	151-153	3
β-strand	154-165	12	1
α-helix	181-184	4
α-helix	186-195	10
β-strand	202-206	5	7
β-strand	209-213	5	7
α-helix	215-221	7
α-helix	223-230	8
β-strand	240-243	4	7
α-helix	248-260	13
α-helix	266-268	3
α-helix	270-279	10
α-helix	283-296	14
α-helix	302-311	10
α-helix	315-326	12

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	99	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Speckle-type POZ protein	A, B	protein	312	Homo sapiens	O43791 (AlphaFold model)
Puckered	C, D	protein	7		Q9VHV8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3HU6_1 Speckle-type POZ protein (chains A, B)
GSKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLS
LYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRGFLLDE
ANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLC
VAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPN
LDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFI
NYHATDVLETSG

Sequence of entity 2 (C, D), FASTA

>3HU6_2 Puckered (chains C, D)
DEVTSTT

Primary citation

Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases. Zhuang, M., Calabrese, M.F., Liu, J. et al. Mol Cell (2009) 36:39-50. DOI 10.1016/j.molcel.2009.09.022 · PubMed

Other PDB entries of the same protein (UniProt O43791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IVV 1.25 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
7LIN 1.44 Å, X-ray structure of SPOP MATH domain (D140G) in complex with a 53BP1 peptide
7D3D 1.45 Å, Crystal structure of SPOP bound with a peptide
9HFV 1.45 Å, MyD88 peptide_2 bound to SPOP MATH domain
7LIP 1.48 Å, X-ray structure of SPOP MATH domain (D140G)
4HS2 1.53 Å, Crystal Structure of the Human SPOP C-terminal Domain
3HQL 1.66 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
3HQM 1.74 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
3IVB 1.75 Å, Structures of SPOP-Substrate Complexes: Insights into Architectures of BTB-Cul3…
6I5P 1.81 Å, Co-crystal structure of human SPOP MATH domain (E47K) and human BRD3 fragment
6I68 1.85 Å, Co-crystal structure of human SPOP MATH domain (M117V) and human BRD3 fragment
6I41 1.9 Å, Co-crystal structure of human SPOP MATH domain (wild-type) and human BRD3 fragment

Browse structure collections

About this viewer

MolViewer shows 3HU6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.