3HXO: Von Willebrand Factor (VWF) A1 Domain

Crystal Structure of Von Willebrand Factor (VWF) A1 Domain in Complex with DNA Aptamer ARC1172, an Inhibitor of VWF-Platelet Binding. Determined by X-ray diffraction at 2.4 Å resolution. Released 17 Nov 2009.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,674
Mol. weight: 36.77 kDa
Released: 17 Nov 2009

Explore 3HXO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HXO contains 10 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	509	1	1
β-strand	513-520	8	2
β-strand	522	1	3
α-helix	527-542	16
β-strand	544	1	1
β-strand	546	1	2
β-strand	551-558	8	2
β-strand	562-566	5	2
α-helix	574-582	9
α-helix	584-586	3
β-strand	589	1	3
α-helix	594-600	7
α-helix	601-605	5
β-strand	615-622	8	2
α-helix	628-633	6
α-helix	634-643	10
β-strand	646-652	7	2
α-helix	659-666	8
α-helix	681-684	4
α-helix	687-695	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
von Willebrand factor	A	protein	209	Homo sapiens	P04275 (AlphaFold model)
Aptamer ARC1172	B	DNA	42

Sequence of entity 1 (A), FASTA

>3HXO_1 von Willebrand factor (chains A)
EDISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVV
EYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASR
IALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFV
LSSVDELEQQRDEIVSYLCDLAPEAPPPT

Sequence of entity 2 (B), FASTA

>3HXO_2 Aptamer ARC1172 (chains B)
GGCGTGCAGTGCCTTCGGCCGTGCGGTGCCTCCGTCACGCCT

Primary citation

A structural explanation for the antithrombotic activity of ARC1172, a DNA aptamer that binds von Willebrand factor domain A1. Huang, R.H., Fremont, D.H., Diener, J.L. et al. Structure (2009) 17:1476-1484. DOI 10.1016/j.str.2009.09.011 · PubMed

Other PDB entries of the same protein (UniProt P04275 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BV8 1.59 Å, G1324S mutation in von Willebrand Factor A1 domain
7EOW 1.6 Å, High-resolution structure of vWF A1 domain in complex with caplacizumab, the first…
3ZQK 1.7 Å, Von Willebrand Factor A2 domain with calcium
1ATZ 1.8 Å, Human von willebrand factor A3 domain
1IJB 1.8 Å, The von Willebrand Factor mutant (I546V) A1 domain
2ADF 1.9 Å, Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody…
3GXB 1.9 Å, Crystal structure of VWF A2 domain
3PPV 1.9 Å, Crystal structure of an engineered VWF A2 domain (N1493C and C1670S)
3PPW 1.9 Å, Crystal structure of the D1596A mutant of an engineered VWF A2 domain (N1493C and C1670S)
3PPX 1.91 Å, Crystal structure of the N1602A mutant of an engineered VWF A2 domain (N1493C and C1670S)
1FNS 2.0 Å, Crystal structure of the von willebrand factor (VWF) A1 domain I546V mutant in complex…
3PPY 2.0 Å, Crystal structure of the D1596A/N1602A double mutant of an engineered VWF A2 domain…

Browse structure collections

About this viewer

MolViewer shows 3HXO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.