Crystal Structure of the third PDZ domain of PSD-95. Determined by X-ray diffraction at 1.35 Å resolution. Released 7 Apr 2010.
Explore 3I4W in 3D Show helices and sheets RCSB PDB PDBe
3I4W contains 12 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 312-317 | 6 | 1 |
| β-strand | 319 | 1 | 2 |
| β-strand | 322 | 1 | 2 |
| β-strand | 325-331 | 7 | 1 |
| β-strand | 334-341 | 8 | 1 |
| α-helix | 346-350 | 5 | |
| β-strand | 357-362 | 6 | 1 |
| β-strand | 365-366 | 2 | 1 |
| α-helix | 372-380 | 9 | |
| β-strand | 385-392 | 8 | 1 |
| α-helix | 394-401 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Disks large homolog 4 | A, B, C, D | protein | 104 | Homo sapiens | P78352 (AlphaFold model) |
>3I4W_1 Disks large homolog 4 (chains A, B, C, D) MGLGEEDIPREPRRIVIHRGSTGLGFNIVGGENGEGIFISFILAGGPADLSGELRKGDQI LSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAK
Novel conformational aspects of the third PDZ domain of the neuronal post-synaptic density-95 protein revealed from two 1.4A X-ray structures. Camara-Artigas, A., Murciano-Calles, J., Gavira, J.A. et al. J Struct Biol (2010) 170:565-569. DOI 10.1016/j.jsb.2010.03.005 · PubMed
Other PDB entries of the same protein (UniProt P78352 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3I4W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.