3I5P: Nup170(aa979-1502), S.cerevisiae

Nup170(aa979-1502), S.cerevisiae. Determined by X-ray diffraction at 3.2 Å resolution. Released 11 Aug 2009.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 3,551
Mol. weight: 61.12 kDa
Released: 11 Aug 2009

Explore 3I5P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3I5P contains 29 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 0 β-strands

Element	Residues	Length
α-helix	1001-1015	15
α-helix	1022-1032	11
α-helix	1045-1056	12
α-helix	1060-1075	16
α-helix	1079-1086	8
α-helix	1095-1114	20
α-helix	1146-1149	4
α-helix	1155-1167	13
α-helix	1171-1176	6
α-helix	1182-1188	7
α-helix	1196-1201	6
α-helix	1203-1206	4
α-helix	1210-1221	12
α-helix	1229-1242	14
α-helix	1258-1281	24
α-helix	1287-1299	13
α-helix	1304-1307	4
α-helix	1308-1312	5
α-helix	1318-1328	11
α-helix	1333-1350	18
α-helix	1357-1378	22
α-helix	1387-1399	13
α-helix	1404-1406	3
α-helix	1413-1419	7
α-helix	1423-1436	14
α-helix	1442-1456	15
α-helix	1460-1463	4
α-helix	1469-1472	4
α-helix	1483-1491	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoporin NUP170	A	protein	525	Saccharomyces cerevisiae	P38181 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3I5P_1 Nucleoporin NUP170 (chains A)
GPSIEYTATALQERCGSFCSASDILGFRAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQ
IVDDLSIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQY
YDKRILVYDLVFDTLIKVDELAEKKQSSKTQNQISISNDDEVKLRQKSYEAALKYNDRLF
HYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGSSLKISNILWVYYSRRSKFFESAEIL
YRLATSNFDITLFERIEFLSRANGFCNSVSPLSQKQRIVQLASRIQDACEVAGIQGDILS
LVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIM
AKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNF
FYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYK
SDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFYKE

Primary citation

Architectural nucleoporins Nup157/170 and Nup133 are structurally related and descend from a second ancestral element. Whittle, J.R., Schwartz, T.U. J Biol Chem (2009) 284:28442-28452. DOI 10.1074/jbc.M109.023580 · PubMed

Other PDB entries of the same protein (UniProt P38181 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3I5Q 2.2 Å, Nup170(aa1253-1502) at 2.2 A, S.cerevisiae
7WOO 3.71 Å, Cryo-EM structure of the inner ring protomer of the Saccharomyces cerevisiae nuclear…
7WOT 3.73 Å, Cryo-EM structure of the inner ring monomer of the Saccharomyces cerevisiae nuclear pore…
8TJ5 6.6 Å, Inner spoke ring of the yeast NPC
7N85 7.6 Å, Inner ring spoke from the isolated yeast NPC
7N9F 37.0 Å, Structure of the in situ yeast NPC
8ZZA Integrative structure and functional anatomy of a single spoke of a nuclear pore complex
8ZZB Integrative structure and functional anatomy of three spokes of a nuclear pore complex
8ZZC Integrative structure and functional anatomy of eight spokes of a nuclear pore complex
9A0F Integrative model of the wild type yeast nuclear pore complex
9A0G Integrative model of Nup116 knockout (at 25C) yeast nuclear pore complex
9A1P Comprehensive structure and functional adaptations of the yeast nuclear pore complex

Browse structure collections

About this viewer

MolViewer shows 3I5P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.