3I5R: PI3K SH3 domain

PI3K SH3 domain in complex with a peptide ligand. Determined by X-ray diffraction at 1.7 Å resolution. Released 2 Mar 2010.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 781
Mol. weight: 10.78 kDa
Released: 2 Mar 2010

Explore 3I5R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3I5R contains 5 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	1
β-strand	14	1	2
β-strand	21	1	1
β-strand	24	1	2
β-strand	29-33	5	1
α-helix	34-40	7
α-helix	46-48	3
α-helix	50-53	4
β-strand	55-60	6	1
β-strand	65-70	6	1
α-helix	71-73	3
β-strand	74-81	8	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 3-kinase regulatory subunit alpha	A	protein	83	Homo sapiens	P27986 (AlphaFold model)
Peptide ligand	B	protein	12

Sequence of entity 1 (A), FASTA

>3I5R_1 Phosphatidylinositol 3-kinase regulatory subunit alpha (chains A)
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKIS

Sequence of entity 2 (B), FASTA

>3I5R_2 Peptide ligand (chains B)
HSKRPLPPLPSL

Primary citation

Structural studies of the phosphatidylinositol 3-kinase (PI3K) SH3 domain in complex with a peptide ligand: role of the anchor residue in ligand binding. Batra-Safferling, R., Granzin, J., Modder, S. et al. Biol Chem (2010) 391:33-42. DOI 10.1515/BC.2010.003 · PubMed

Other PDB entries of the same protein (UniProt P27986 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GJI 0.9 Å, PI3K p85 N-terminal SH2 domain/CD28-derived peptide complex
5AUL 1.1 Å, PI3K p85 C-terminal SH2 domain/CD28-derived peptide complex
7CIO 1.1 Å, Molecular interactions of cytoplasmic region of CTLA-4 with SH2 domains of PI3-kinase
7RNS 1.14 Å, nSH2 domain of p85-alpha subunit of phosphatidylinositol 3-kinase in complex with an…
1H9O 1.79 Å, Phosphatidylinositol 3-kinase, P85-alpha subunit: C-terminal SH2 domain complexed with a…
2IUG 1.89 Å, Crystal structure of the PI3-kinase p85 N-terminal SH2 domain
1PBW 2.0 Å, Structure of BCR-homology (BH) domain
1PHT 2.0 Å, Phosphatidylinositol 3-kinase P85-alpha subunit SH3 domain, residues 1-85
2IUH 2.0 Å, Crystal structure of the PI3-kinase p85 N-terminal SH2 domain in complex with c-Kit…
4JPS 2.2 Å, Co-crystal Structures of the Lipid Kinase PI3K alpha with Pan and Isoform Selective…
7PG5 2.2 Å, Crystal Structure of PI3Kalpha
6PYR 2.21 Å, Human PI3Kdelta in complex with Compound 2-10 ((3S)-3-benzyl-3-methyl-5-[5-(2-methylpyrim…

Browse structure collections

About this viewer

MolViewer shows 3I5R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.