3IHR: Uch37

Crystal Structure of Uch37. Determined by X-ray diffraction at 2.95 Å resolution. Released 11 Aug 2009.

Method: X-ray diffraction
Resolution: 2.95 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,299
Mol. weight: 38.02 kDa
Released: 11 Aug 2009

Explore 3IHR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3IHR contains 15 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	15-25	11
β-strand	28	1	1
β-strand	30-34	5	2
α-helix	40-44	5
α-helix	47	1
β-strand	49-57	9	2
β-strand	67-68	2	2
α-helix	85-87	3
α-helix	88-98	11
β-strand	106	1	1
α-helix	108-118	11
α-helix	123-131	9
α-helix	134-141	8
β-strand	163-171	9	2
β-strand	174-179	6	2
α-helix	185	1
β-strand	186-190	5	2
β-strand	192	1	3
β-strand	195	1	3
α-helix	197-214	18
β-strand	218-225	8	2
α-helix	227-244	18
α-helix	246-247	2
α-helix	256-287	32
α-helix	292-299	8
α-helix	300-302	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin carboxyl-terminal hydrolase isozyme L5	A	protein	328	Homo sapiens	Q9Y5K5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3IHR_1 Ubiquitin carboxyl-terminal hydrolase isozyme L5 (chains A)
STGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQR
QLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLK
TLAEHQQLIPLVEKAKEKQNAKKAQETK

Primary citation

Structural characterization of human Uch37. Burgie, S.E., Bingman, C.A., Soni, A.B. et al. Proteins (2012) 80:649-654. DOI 10.1002/prot.23147 · PubMed

Other PDB entries of the same protein (UniProt Q9Y5K5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RII 2.0 Å, Crystal structure of the catalytic domain of UCHL5, a proteasome-associated human…
3A7S 2.2 Å, Catalytic domain of UCH37
3TB3 2.3 Å, Crystal structure of the UCH domain of UCH-L5 with 6 residues deleted
4UEL 2.3 Å, UCH-L5 in complex with ubiquitin-propargyl bound to the RPN13 DEUBAD domain
3RIS 2.4 Å, Crystal structure of the catalytic domain of UCHL5, a proteasome-associated human…
9E7K 2.41 Å, Crystal structure of the UCH37 RPN13 DEUBAD complex bound to an inhibitory nanobody in…
4UEM 2.82 Å, UCH-L5 in complex with the RPN13 DEUBAD domain
4WLP 3.1 Å, Crystal structure of UCH37-NFRKB Inhibited Deubiquitylating Complex
4UF6 3.69 Å, UCH-L5 in complex with ubiquitin-propargyl bound to an activating fragment of INO80G
4UF5 3.7 Å, Crystal structure of UCH-L5 in complex with inhibitory fragment of INO80G

Browse structure collections

About this viewer

MolViewer shows 3IHR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.