Structure of human DNA polymerase kappa inserting dATP opposite an 8-oxoG DNA lesion. Determined by X-ray diffraction at 3.2 Å resolution. Released 8 Sept 2009.
Explore 3IN5 in 3D Show helices and sheets RCSB PDB PDBe
3IN5 contains 43 α-helices and 33 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 33-42 | 10 | |
| α-helix | 48-72 | 25 | |
| α-helix | 76-95 | 20 | |
| β-strand | 103-108 | 6 | 1 |
| α-helix | 111-119 | 9 | |
| α-helix | 121-125 | 5 | |
| β-strand | 128-132 | 5 | 2 |
| β-strand | 135-139 | 5 | 2 |
| α-helix | 141-145 | 5 | |
| α-helix | 154-160 | 7 | |
| β-strand | 165-167 | 3 | 2 |
| α-helix | 171-188 | 18 | |
| β-strand | 193-194 | 2 | 1 |
| β-strand | 199-203 | 5 | 1 |
| α-helix | 205-210 | 6 | |
| α-helix | 211-213 | 3 | |
| α-helix | 216-219 | 4 | |
| β-strand | 220-221 | 2 | 3 |
| β-strand | 284-285 | 2 | 3 |
| α-helix | 290-305 | 16 | |
| β-strand | 309-314 | 6 | 1 |
| α-helix | 317-326 | 10 | |
| β-strand | 332-334 | 3 | 1 |
| α-helix | 339-346 | 8 | |
| β-strand | 350 | 1 | 4 |
| α-helix | 351-353 | 3 | |
| α-helix | 359-367 | 9 | |
| β-strand | 372 | 1 | 4 |
| α-helix | 373-378 | 6 | |
| α-helix | 380-386 | 7 | |
| α-helix | 389-399 | 11 | |
| β-strand | 415-425 | 11 | 5 |
| α-helix | 428-448 | 21 | |
| β-strand | 455-462 | 8 | 5 |
| β-strand | 467-473 | 7 | 5 |
| α-helix | 481-498 | 18 | |
| β-strand | 506-514 | 9 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 33-44 | 12 | |
| α-helix | 48-71 | 24 | |
| α-helix | 76-95 | 20 | |
| β-strand | 103-108 | 6 | 6 |
| α-helix | 111-119 | 9 | |
| α-helix | 121-123 | 3 | |
| β-strand | 128-132 | 5 | 7 |
| β-strand | 135-139 | 5 | 7 |
| α-helix | 141-144 | 4 | |
| α-helix | 154-159 | 6 | |
| β-strand | 165-167 | 3 | 7 |
| α-helix | 168-169 | 2 | |
| α-helix | 171-188 | 18 | |
| β-strand | 193-196 | 4 | 6 |
| β-strand | 199-203 | 5 | 6 |
| α-helix | 205-211 | 7 | |
| α-helix | 217-219 | 3 | |
| β-strand | 220 | 1 | 8 |
| β-strand | 285 | 1 | 8 |
| α-helix | 290-305 | 16 | |
| β-strand | 309-314 | 6 | 6 |
| α-helix | 317-326 | 10 | |
| β-strand | 332-334 | 3 | 6 |
| α-helix | 339-346 | 8 | |
| β-strand | 350 | 1 | 9 |
| α-helix | 351-353 | 3 | |
| α-helix | 359-366 | 8 | |
| β-strand | 372 | 1 | 9 |
| α-helix | 373-378 | 6 | |
| α-helix | 380-386 | 7 | |
| α-helix | 389-400 | 12 | |
| β-strand | 415-425 | 11 | 10 |
| α-helix | 428-447 | 20 | |
| β-strand | 453-462 | 10 | 10 |
| β-strand | 467-468 | 2 | 10 |
| β-strand | 471-478 | 8 | 10 |
| α-helix | 481-497 | 17 | |
| α-helix | 503-504 | 2 | |
| β-strand | 506-514 | 9 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA polymerase kappa | A, B | protein | 508 | Homo sapiens | Q9UBT6 (AlphaFold model) |
| DNA (5'-d(*gp*g*gp*gp*gp*ap*ap*gp*gp*ap*cp*tp*(doc))-3') | P, Q | DNA | 13 | ||
| DNA (5'-D(*C*CP*TP*AP*(8OG)P*GP*AP*GP*TP*CP*CP*TP*TP*CP*CP*CP*CP*C)-3') | T, U | DNA | 18 |
>3IN5_1 DNA polymerase kappa (chains A, B) MGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQ LRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLST SNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLD EAYLNITKHLEERQNWPEDKRRYFIKMGSSVENDNPGKEVNKLSEHERSISPLLFEESPS DVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFRIEQKTTLTASAGIAPNTM LAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTELYQ QRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQEL CSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKELLKTEIDA DFPHPLRLRLMGVRISSFPNEEDRKHQQ
>3IN5_2 DNA (5'-D(*GP*G*GP*GP*GP*AP*AP*GP*GP*AP*CP*TP*(DOC))-3') (chains P, Q) GGGGGAAGGACTC
>3IN5_3 DNA (5'-D(*C*CP*TP*AP*(8OG)P*GP*AP*GP*TP*CP*CP*TP*TP*CP*CP*CP*CP*C)-3') (chains T, U) CCTAGGAGTCCTTCCCCC
Structure of human DNA polymerase kappa inserting dATP opposite an 8-oxoG DNA lesion. Vasquez-Del Carpio, R., Silverstein, T.D., Lone, S. et al. PLoS One (2009) 4:e5766-e5766. DOI 10.1371/journal.pone.0005766 · PubMed
Other PDB entries of the same protein (UniProt Q9UBT6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3IN5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.