Crystal structure of 2-Fluorohistine labeled Protective Antigen (pH 5.8). Determined by X-ray diffraction at 2.1 Å resolution. Released 15 Feb 2012.
Explore 3Q8F in 3D Show helices and sheets RCSB PDB PDBe
3Q8F contains 22 α-helices and 57 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 19-24 | 6 | 1 |
| β-strand | 32-38 | 7 | 1 |
| β-strand | 42 | 1 | 2 |
| β-strand | 45 | 1 | 3 |
| α-helix | 47-49 | 3 | |
| β-strand | 59 | 1 | 4 |
| β-strand | 62-69 | 8 | 1 |
| β-strand | 75-77 | 3 | 5 |
| β-strand | 87-91 | 5 | 1 |
| β-strand | 95-97 | 3 | 1 |
| β-strand | 106-108 | 3 | 5 |
| β-strand | 114-121 | 8 | 1 |
| β-strand | 129 | 1 | 4 |
| β-strand | 130 | 1 | 3 |
| β-strand | 133 | 1 | 2 |
| β-strand | 135-137 | 3 | 6 |
| β-strand | 143-145 | 3 | 6 |
| β-strand | 151-152 | 2 | 1 |
| α-helix | 185-190 | 6 | |
| β-strand | 192-196 | 5 | 1 |
| β-strand | 201-205 | 5 | 1 |
| β-strand | 219 | 1 | 1 |
| α-helix | 235-240 | 6 | |
| α-helix | 249-252 | 4 | |
| β-strand | 256 | 1 | 7 |
| β-strand | 262-273 | 12 | 8 |
| β-strand | 288-292 | 5 | 8 |
| β-strand | 293-297 | 5 | 9 |
| β-strand | 328-334 | 7 | 9 |
| α-helix | 346-349 | 4 | |
| β-strand | 357-368 | 12 | 8 |
| β-strand | 374 | 1 | 10 |
| α-helix | 378-380 | 3 | |
| β-strand | 381-385 | 5 | 9 |
| β-strand | 389-394 | 6 | 9 |
| β-strand | 405 | 1 | 10 |
| β-strand | 409-411 | 3 | 8 |
| α-helix | 417-418 | 2 | |
| β-strand | 419-420 | 2 | 8 |
| α-helix | 429-431 | 3 | |
| β-strand | 433-435 | 3 | 8 |
| α-helix | 436-445 | 10 | |
| β-strand | 447-452 | 6 | 9 |
| β-strand | 458-463 | 6 | 11 |
| β-strand | 468-476 | 9 | 11 |
| α-helix | 477-487 | 11 | |
| β-strand | 488-493 | 6 | 7 |
| β-strand | 501-506 | 6 | 7 |
| β-strand | 508 | 1 | 12 |
| α-helix | 513-515 | 3 | |
| α-helix | 519-520 | 2 | |
| β-strand | 521-522 | 2 | 13 |
| α-helix | 523-531 | 9 | |
| β-strand | 534 | 1 | 14 |
| β-strand | 541-542 | 2 | 14 |
| β-strand | 545-546 | 2 | 14 |
| α-helix | 547-549 | 3 | |
| β-strand | 550-554 | 5 | 7 |
| α-helix | 556-568 | 13 | |
| α-helix | 574-580 | 7 | |
| α-helix | 581 | 1 | |
| β-strand | 582-583 | 2 | 13 |
| β-strand | 584 | 1 | 12 |
| β-strand | 588-593 | 6 | 7 |
| β-strand | 596-598 | 3 | 15 |
| β-strand | 604-607 | 4 | 15 |
| α-helix | 609-614 | 6 | |
| β-strand | 619-623 | 5 | 16 |
| β-strand | 626-629 | 4 | 16 |
| α-helix | 633-637 | 5 | |
| β-strand | 639-647 | 9 | 17 |
| β-strand | 653-655 | 3 | 17 |
| β-strand | 666-668 | 3 | 16 |
| β-strand | 674-677 | 4 | 16 |
| α-helix | 685-687 | 3 | |
| β-strand | 695-702 | 8 | 17 |
| α-helix | 703-705 | 3 | |
| β-strand | 724-730 | 7 | 17 |
| α-helix | 731-733 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protective antigen | A | protein | 735 | Bacillus anthracis | P13423 (AlphaFold model) |
>3Q8F_1 Protective antigen (chains A) EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY QRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDN DGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHT SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNL QYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRY DMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNG IKKILIFSKKGYEIG
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
Water and common crystallization additives (PG4) are not listed.
pH effects on binding between the anthrax protective antigen and the host cellular receptor CMG2. Rajapaksha, M., Lovell, S., Janowiak, B.E. et al. Protein Sci (2012) 21:1467-1480. DOI 10.1002/pro.2136 · PubMed
Other PDB entries of the same protein (UniProt P13423 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3Q8F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.