3IVB: Speckle-type POZ protein

Structures of SPOP-Substrate Complexes: Insights into Architectures of BTB-Cul3 Ubiquitin Ligases: SPOPMATH-MacroH2ASBCpep1. Determined by X-ray diffraction at 1.75 Å resolution. Released 20 Oct 2009.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,307
Mol. weight: 18.33 kDa
Ligands: ZN
Released: 20 Oct 2009

Explore 3IVB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3IVB contains 6 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	30-38	9	1
α-helix	45-48	4
β-strand	52-53	2	2
α-helix	54-56	3
β-strand	57	1	2
β-strand	67-72	6	2
α-helix	78-80	3
β-strand	83-90	8	2
β-strand	98-107	10	1
β-strand	113-118	6	1
β-strand	123-125	3	1
β-strand	130-138	9	2
α-helix	139-143	5
α-helix	145-147	3
α-helix	151-153	3
β-strand	155-163	9	1

Chain M: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	171	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Speckle-type POZ protein	A	protein	145	Homo sapiens	O43791 (AlphaFold model)
Core histone macro-H2A.1	M	protein	15		O75367 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3IVB_1 Speckle-type POZ protein (chains A)
GSGGSGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESK
DYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDF
LLDEANGLLPDDKLTLFCEVSVVQD

Sequence of entity 2 (M), FASTA

>3IVB_2 Core histone macro-H2A.1 (chains M)
KAASADSTTEGTPAD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	5

Water and common crystallization additives (CL) are not listed.

Primary citation

Structure 9. Zhuang, M., Calabrese, M.F., Liu, J. et al. To be published.

Other PDB entries of the same protein (UniProt O43791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IVV 1.25 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
7LIN 1.44 Å, X-ray structure of SPOP MATH domain (D140G) in complex with a 53BP1 peptide
7D3D 1.45 Å, Crystal structure of SPOP bound with a peptide
9HFV 1.45 Å, MyD88 peptide_2 bound to SPOP MATH domain
7LIP 1.48 Å, X-ray structure of SPOP MATH domain (D140G)
4HS2 1.53 Å, Crystal Structure of the Human SPOP C-terminal Domain
3HQL 1.66 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
3HQM 1.74 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
6I5P 1.81 Å, Co-crystal structure of human SPOP MATH domain (E47K) and human BRD3 fragment
6I68 1.85 Å, Co-crystal structure of human SPOP MATH domain (M117V) and human BRD3 fragment
6I41 1.9 Å, Co-crystal structure of human SPOP MATH domain (wild-type) and human BRD3 fragment
9HGG 1.9 Å, SETD2 peptide bound to SPOP MATH domain

Browse structure collections

About this viewer

MolViewer shows 3IVB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.