3IVQ: Speckle-type POZ protein

Name: PDB 3IVQ: Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of BTB-Cul3 Ubiquitin Ligases: SPOPMATH-CiSBC2
Published: 2009-10-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of BTB-Cul3 Ubiquitin Ligases: SPOPMATH-CiSBC2. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Oct 2009.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,493
Mol. weight: 35.7 kDa
Released: 20 Oct 2009

Explore 3IVQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3IVQ contains 11 α-helices and 21 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	31-38	8	1
α-helix	41-43	3
β-strand	52-53	2	2
α-helix	54-56	3
β-strand	57-59	3	2
β-strand	65-72	8	2
α-helix	78-80	3
β-strand	83-92	10	2
β-strand	98-107	10	1
β-strand	113-118	6	1
β-strand	123-125	3	1
β-strand	130-138	9	2
α-helix	139-144	6
α-helix	146-149	4
α-helix	151-153	3
β-strand	155-165	11	1

Chain B: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	31-38	8	3
α-helix	41-43	3
β-strand	52-53	2	4
β-strand	57-59	3	4
β-strand	65-72	8	4
α-helix	78-80	3
β-strand	83-92	10	4
β-strand	98-107	10	3
β-strand	113-125	13	3
β-strand	130-138	9	4
α-helix	139-143	5
α-helix	145-147	3
α-helix	151-153	3
β-strand	155-165	11	3

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1363	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Speckle-type POZ protein	A, B	protein	145	Homo sapiens	O43791 (AlphaFold model)
CiSBC2	C, D	protein	12

Sequence of entity 1 (A, B), FASTA

>3IVQ_1 Speckle-type POZ protein (chains A, B)
GSGGSGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESK
DYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDF
LLDEANGLLPDDKLTLFCEVSVVQD

Sequence of entity 2 (C, D), FASTA

>3IVQ_2 CiSBC2 (chains C, D)
NTLFPDVSSSTH

Primary citation

Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of BTB-Cul3 Ubiquitin Ligases. Zhuang, M., Calabrese, M.F., Liu, J. et al. Mol Cell (2009) 36:39-50. DOI 10.1016/j.molcel.2009.09.022 · PubMed

Other PDB entries of the same protein (UniProt O43791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IVV 1.25 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
7LIN 1.44 Å, X-ray structure of SPOP MATH domain (D140G) in complex with a 53BP1 peptide
7D3D 1.45 Å, Crystal structure of SPOP bound with a peptide
9HFV 1.45 Å, MyD88 peptide_2 bound to SPOP MATH domain
7LIP 1.48 Å, X-ray structure of SPOP MATH domain (D140G)
4HS2 1.53 Å, Crystal Structure of the Human SPOP C-terminal Domain
3HQL 1.66 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
3HQM 1.74 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
3IVB 1.75 Å, Structures of SPOP-Substrate Complexes: Insights into Architectures of BTB-Cul3…
6I5P 1.81 Å, Co-crystal structure of human SPOP MATH domain (E47K) and human BRD3 fragment
6I68 1.85 Å, Co-crystal structure of human SPOP MATH domain (M117V) and human BRD3 fragment
6I41 1.9 Å, Co-crystal structure of human SPOP MATH domain (wild-type) and human BRD3 fragment

Browse structure collections

About this viewer

MolViewer shows 3IVQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.