CryoEM single particle reconstruction of anthrax toxin protective antigen pore at 2.9 Angstrom resolution. Determined by electron microscopy at 2.9 Å resolution. Released 11 Mar 2015.
Explore 3J9C in 3D Show helices and sheets RCSB PDB PDBe
3J9C contains 15 α-helices and 32 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 185-190 | 6 | |
| β-strand | 192-196 | 5 | 1 |
| β-strand | 201-205 | 5 | 1 |
| α-helix | 206 | 1 | |
| α-helix | 208-211 | 4 | |
| α-helix | 216-218 | 3 | |
| β-strand | 219 | 1 | 1 |
| α-helix | 235-240 | 6 | |
| α-helix | 249-252 | 4 | |
| β-strand | 256 | 1 | 2 |
| β-strand | 262-273 | 12 | 3 |
| β-strand | 276-299 | 24 | 4 |
| β-strand | 302-311 | 10 | 5 |
| β-strand | 316-325 | 10 | 5 |
| β-strand | 328-351 | 24 | 4 |
| β-strand | 358-368 | 11 | 3 |
| β-strand | 375-376 | 2 | 6 |
| β-strand | 377 | 1 | 7 |
| β-strand | 378-385 | 8 | 6 |
| β-strand | 389-395 | 7 | 6 |
| β-strand | 402 | 1 | 7 |
| β-strand | 409-411 | 3 | 3 |
| α-helix | 417-418 | 2 | |
| β-strand | 419-421 | 3 | 3 |
| β-strand | 423 | 1 | 8 |
| β-strand | 431 | 1 | 8 |
| β-strand | 432-434 | 3 | 3 |
| α-helix | 436-445 | 10 | |
| β-strand | 448-458 | 11 | 6 |
| β-strand | 460-462 | 3 | 9 |
| β-strand | 469-471 | 3 | 9 |
| α-helix | 477-485 | 9 | |
| β-strand | 488-493 | 6 | 2 |
| β-strand | 501-506 | 6 | 2 |
| α-helix | 515-517 | 3 | |
| α-helix | 519-520 | 2 | |
| β-strand | 522 | 1 | 10 |
| α-helix | 523-531 | 9 | |
| β-strand | 534 | 1 | 11 |
| β-strand | 541-542 | 2 | 11 |
| β-strand | 545-546 | 2 | 11 |
| α-helix | 547-549 | 3 | |
| β-strand | 550-554 | 5 | 2 |
| α-helix | 556-568 | 13 | |
| α-helix | 574-577 | 4 | |
| β-strand | 582 | 1 | 10 |
| β-strand | 588-593 | 6 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protective antigen PA-63 | A | protein | 562 | Bacillus anthracis | P13423 (AlphaFold model) |
>3J9C_1 Protective antigen PA-63 (chains A) TVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPY SDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNT STSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLN TADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPS KNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDT GSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGF NEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRD KRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLK EVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSEN GDTSTNGIKKILIFSKKGYEIG
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
Atomic structure of anthrax protective antigen pore elucidates toxin translocation. Jiang, J., Pentelute, B.L., Collier, R.J. et al. Nature (2015) 521:545-549. DOI 10.1038/nature14247 · PubMed
Other PDB entries of the same protein (UniProt P13423 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3J9C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.