3JC2: PDB entry 3JC2

The structure of the mammalian Sec61 channel opened by a signal sequence. Determined by electron microscopy at 3.6 Å resolution. Released 13 Jan 2016.

Method: Electron microscopy
Resolution: 3.6 Å
Organisms: Canis lupus familiaris, Bos taurus
Chains: 4
Atoms: 3,911
Mol. weight: 64.09 kDa
Released: 13 Jan 2016

Explore 3JC2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JC2 contains 24 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 1: 19 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	18-19	2	1
α-helix	20-22	3
α-helix	28-45	18
α-helix	48-50	3
α-helix	82-96	15
α-helix	106-110	5
α-helix	113-133	21
α-helix	148-172	25
α-helix	178-195	18
α-helix	218-222	5
α-helix	242-258	17
β-strand	262-268	7	2
α-helix	269	1
β-strand	276-282	7	2
α-helix	286-288	3
α-helix	290-311	22
α-helix	340-344	5
α-helix	358-382	25
α-helix	387-397	11
α-helix	406-414	9
α-helix	417-438	22
α-helix	448-465	18

Chain 2: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	9-24	16
α-helix	30-56	27
α-helix	59-62	4

Chain 3: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	27-28	2	1
α-helix	30-47	18

Chain w: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	14-27	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein transport protein Sec61 subunit alpha isoform 1	1	protein	476	Canis lupus familiaris	P38377 (AlphaFold model)
Protein transport protein Sec61 subunit gamma	2	protein	62	Canis lupus familiaris	P60058 (AlphaFold model)
Prolactin	w	protein	19	Bos taurus	P01239 (AlphaFold model)
Protein transport protein Sec61 subunit beta	3	protein	32	Canis lupus familiaris

Sequence of entity 1 (1), FASTA

>3JC2_1 Protein transport protein Sec61 subunit alpha isoform 1 (chains 1)
MAIKFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSAD
PFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFG
MIITIGQSIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGIS
LFIATNICETIVWKAFSPTTVNTGRGMEFEGAIIALFHLLATRTDKVRALREAFYRQNLP
NLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSN
LYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCHYLSPPESFGSVLEDPVH
AVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTA
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF

Sequence of entity 2 (2), FASTA

>3JC2_2 Protein transport protein Sec61 subunit gamma (chains 2)
FVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIV
GG

Sequence of entity 3 (w), FASTA

>3JC2_3 Prolactin (chains w)
RLLLLLVVSNLLLCQGVVS

Sequence of entity 4 (3), FASTA

>3JC2_4 Protein transport protein Sec61 subunit beta (chains 3)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Primary citation

Structure of the Sec61 channel opened by a signal sequence. Voorhees, R.M., Hegde, R.S. Science (2016) 351:88-91. DOI 10.1126/science.aad4992 · PubMed

Other PDB entries of the same protein (UniProt P38377 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Z3T 2.69 Å, Structure of canine Sec61 inhibited by mycolactone
8RJB 2.69 Å, Structure of the rabbit 80S ribosome stalled on a 2-TMD rhodopsin intermediate in…
8RJD 2.79 Å, Structure of the rabbit 80S ribosome stalled on a 2-TMD rhodopsin intermediate in…
8RJC 2.9 Å, Structure of the rabbit 80S ribosome stalled on a 2-TMD rhodopsin intermediate in…
7TM3 3.25 Å, Structure of the rabbit 80S ribosome stalled on a 2-TMD Rhodopsin intermediate in…
8OJ8 3.3 Å, 60S ribosomal subunit bound to the E3-UFM1 complex - state 1 (native)
8BTK 3.5 Å, Structure of the TRAP complex with the Sec translocon and a translating ribosome
7TUT 3.88 Å, Structure of the rabbit 80S ribosome stalled on a 4-TMD Rhodopsin intermediate in…
6R7Q 3.9 Å, Structure of XBP1u-paused ribosome nascent chain complex with Sec61.
6FTI 4.2 Å, Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the…
6FTJ 4.7 Å, Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the…
2WWB 6.48 Å, cryo-EM structure of the mammalian SEC61 complex bound to the actively translating wheat…

Browse structure collections

About this viewer

MolViewer shows 3JC2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.