3JRP: SEC13 with NUP145C (AA109-179) insertion blade

SEC13 with NUP145C (AA109-179) insertion blade. Determined by X-ray diffraction at 2.6 Å resolution. Released 27 Oct 2009.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 2,687
Mol. weight: 41.7 kDa
Released: 27 Oct 2009

Explore 3JRP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JRP contains 6 α-helices and 31 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	1
β-strand	12-17	6	2
β-strand	23-28	6	2
β-strand	33-39	7	2
β-strand	42-49	8	2
β-strand	56-61	6	3
α-helix	62-63	2
β-strand	65	1	4
β-strand	67	1	4
β-strand	69-74	6	3
β-strand	79-85	7	3
β-strand	88-95	8	3
β-strand	102-107	6	5
α-helix	108-109	2
α-helix	110-112	3
β-strand	115-120	6	5
β-strand	124-129	6	5
β-strand	138-142	5	5
β-strand	148-153	6	6
α-helix	154-156	3
β-strand	172-177	6	6
β-strand	182-188	7	6
β-strand	193-200	8	6
β-strand	207-212	6	7
β-strand	220-226	7	7
β-strand	231-236	6	7
β-strand	244-247	4	7
α-helix	252-253	2
β-strand	257-262	6	8
β-strand	269-273	5	8
β-strand	278-285	8	8
β-strand	288-295	8	8
β-strand	1116-1118	3	1
α-helix	1136-1142	7
β-strand	1152-1155	4	9
β-strand	1159-1163	5	9
β-strand	1171-1175	5	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion protein of protein transport protein SEC13 and nucleoporin NUP145	A	protein	379	Saccharomyces cerevisiae	P49687 (AlphaFold model), Q04491 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3JRP_1 FUSION PROTEIN OF PROTEIN TRANSPORT PROTEIN SEC13 AND NUCLEOPORIN NUP145 (chains A)
GSMVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWR
VDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLV
ASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGA
DNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDN
EQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQG
GGGSGGGGATSKEFDGPCQNEIDLLFSECNDEIDNAKLIMKERRFTASYTFAKFSTGSML
LTKDIVGKSGVSIKRLPTE

Primary citation

Molecular architecture of the Nup84-Nup145C-Sec13 edge element in the nuclear pore complex lattice. Brohawn, S.G., Schwartz, T.U. Nat Struct Mol Biol (2009) 16:1173-1177. DOI 10.1038/nsmb.1713 · PubMed

Other PDB entries of the same protein (UniProt P49687 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KEP 1.82 Å, Crystal structure of the autoproteolytic domain from the nuclear pore complex component…
3KES 2.1 Å, Crystal structure of the autoproteolytic domain from the nuclear pore complex component…
3BG1 3.0 Å, Architecture of a Coat for the Nuclear Pore Membrane
3BG0 3.15 Å, Architecture of a Coat for the Nuclear Pore Membrane
3IKO 3.2 Å, Crystal structure of the heterotrimeric Sec13-Nup145C-Nup84 nucleoporin complex
3JRO 4.0 Å, NUP84-NUP145C-SEC13 edge element of the NPC lattice
4XMM 7.38 Å, Structure of the yeast coat nucleoporin complex, space group C2
4XMN 7.6 Å, Structure of the yeast coat nucleoporin complex, space group P212121
8TIE 8.1 Å, Double nuclear outer ring of Nup84-complexes from the yeast NPC
7N84 11.6 Å, Double nuclear outer ring from the isolated yeast NPC
7N9F 37.0 Å, Structure of the in situ yeast NPC
8ZZ1 Structure of the Nup84 sub-complex of the Nuclear Pore Complex

Browse structure collections

About this viewer

MolViewer shows 3JRP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.