3JVJ: Bromodomain 1 in mouse Brd4

Crystal structure of the bromodomain 1 in mouse Brd4. Determined by X-ray diffraction at 1.55 Å resolution. Released 13 Oct 2009.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,176
Mol. weight: 15.54 kDa
Released: 13 Oct 2009

Explore 3JVJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JVJ contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	44-49	6
α-helix	61-65	5
α-helix	66-71	6
α-helix	72-74	3
α-helix	81-83	3
α-helix	89-92	4
α-helix	97-100	4
α-helix	107-116	10
α-helix	122-139	18
α-helix	145-160	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain-containing protein 4	A	protein	131	Mus musculus	Q9ESU6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3JVJ_1 Bromodomain-containing protein 4 (chains A)
GAMGSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDY
YKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLF
LQKINELPTEE

Primary citation

Structures of the Dual Bromodomains of the P-TEFb-activating Protein Brd4 at Atomic Resolution. Vollmuth, F., Blankenfeldt, W., Geyer, M. J Biol Chem (2009) 284:36547-36556. DOI 10.1074/jbc.M109.033712 · PubMed

Other PDB entries of the same protein (UniProt Q9ESU6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3JVL 1.2 Å, Crystal structure of bromodomain 2 of mouse Brd4
3JVM 1.2 Å, Crystal structure of bromodomain 2 of mouse Brd4
3MUL 1.65 Å, Crystal structure of Brd4 bromodomain 1 with butyrylated histone H3-K(buty)14
3MUK 1.75 Å, Crystal structure of Brd4 bromodomain 1 with propionylated histone H3-K(prop)23
2DWW 1.8 Å, Crystal structure of Bromodomain-containing protein 4
3JVK 1.8 Å, Crystal structure of bromodomain 1 of mouse Brd4 in complex with histone H3-K(ac)14
2JNS Solution structure of the Bromodomain-containing protein 4 ET domain

Browse structure collections

About this viewer

MolViewer shows 3JVJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.