3JXF: CA-like domain of human PTPRZ

CA-like domain of human PTPRZ. Determined by X-ray diffraction at 2.0 Å resolution. Released 22 Dec 2009.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,533
Mol. weight: 61.66 kDa
Released: 22 Dec 2009

Explore 3JXF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JXF contains 28 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	35-37	3
α-helix	46-48	3
α-helix	49-52	4
α-helix	54-57	4
β-strand	65-66	2	1
α-helix	68-70	3
β-strand	72-73	2	2
α-helix	77	1
β-strand	78-83	6	2
β-strand	88	1	3
α-helix	89-90	2
β-strand	94-97	4	2
β-strand	102-105	4	2
β-strand	111-115	5	2
β-strand	121-130	10	2
β-strand	143-144	2	1
β-strand	147	1	1
β-strand	151-158	8	2
α-helix	166-171	6
β-strand	176-185	10	2
α-helix	191-193	3
α-helix	194-202	9
β-strand	209-211	3	2
α-helix	212-214	3
β-strand	216	1	3
α-helix	217-220	4
β-strand	228-233	6	2
β-strand	244-249	6	2
β-strand	253-255	3	2
α-helix	257-261	5
α-helix	262-265	4
β-strand	267-272	6	4
β-strand	275-280	6	4
α-helix	286-288	3
β-strand	297-298	2	2

Chain B: 13 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	34-37	4
α-helix	46-51	6
α-helix	54-57	4
β-strand	65-66	2	5
α-helix	68-70	3
β-strand	72-73	2	6
β-strand	78-83	6	6
β-strand	88	1	7
α-helix	89-90	2
β-strand	94-97	4	6
β-strand	102-105	4	6
β-strand	111-115	5	6
β-strand	121-130	10	6
β-strand	143-144	2	5
β-strand	147	1	5
β-strand	151-158	8	6
α-helix	166-171	6
β-strand	176-186	11	6
α-helix	191-193	3
α-helix	194-202	9
β-strand	209-211	3	6
α-helix	212-214	3
β-strand	216	1	7
α-helix	217-220	4
β-strand	228-233	6	6
β-strand	244-249	6	6
β-strand	253-256	4	6
α-helix	257-261	5
α-helix	262-265	4
β-strand	267-272	6	8
β-strand	275-280	6	8
α-helix	286-288	3
β-strand	297-298	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor-type tyrosine-protein phosphatase zeta	A, B	protein	272	Homo sapiens	P23471 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3JXF_1 Receptor-type tyrosine-protein phosphatase zeta (chains A, B)
PGSEEIGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSL
ENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFP
LEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQA
ALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQ
QSGYVMLMDYLQNNFREQQYKFSRQVFSSYTG

Primary citation

The protein tyrosine phosphatases PTPRZ and PTPRG bind to distinct members of the contactin family of neural recognition molecules. Bouyain, S., Watkins, D.J. Proc Natl Acad Sci U S A (2010) 107:2443-2448. DOI 10.1073/pnas.0911235107 · PubMed

Other PDB entries of the same protein (UniProt P23471 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FN9 1.8 Å, Crystal structure of the C-terminal Fg domain of TNR with the single FN domain of PTPRZ
5AWX 1.86 Å, Crystal structure of Human PTPRZ D1 domain
8FN8 1.89 Å, Crystal structure of the C-terminal Fg domain of TNC with the single FN domain of PTPRZ
3S97 2.3 Å, PTPRZ CNTN1 complex
5H08 2.53 Å, Human PTPRZ D1 domain complexed with NAZ2329

Browse structure collections

About this viewer

MolViewer shows 3JXF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.