3K2S: Double super helix model

Solution structure of double super helix model. Determined by solution scattering. Released 7 Apr 2010.

Method: Solution scattering
Organism: Homo sapiens
Chains: 2
Atoms: 14,920
Mol. weight: 215.99 kDa
Ligands: POV, CLR
Released: 7 Apr 2010

Explore 3K2S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3K2S contains 31 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	17-23	7
α-helix	29-31	3
α-helix	37-39	3
α-helix	49-68	20
α-helix	73-92	20
α-helix	94-97	4
α-helix	101-127	27
α-helix	131-138	8
α-helix	141-148	8
α-helix	165-167	3
α-helix	175-204	30
α-helix	209-211	3
α-helix	213-223	11
α-helix	232-235	4

Chain B: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	15-21	7
α-helix	22-26	5
α-helix	28-37	10
α-helix	45-48	4
α-helix	51-63	13
α-helix	77-88	12
α-helix	89-92	4
α-helix	93-111	19
α-helix	113-119	7
α-helix	130-133	4
α-helix	134-136	3
α-helix	142-146	5
α-helix	151-155	5
α-helix	177-184	8
α-helix	186-201	16
α-helix	218-227	10
α-helix	228-231	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apolipoprotein A-I	A, B	protein	243	Homo sapiens	P02647 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3K2S_1 Apolipoprotein A-I (chains A, B)
DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKL
REQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVE
PLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEA
LKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKL
NTQ

Ligands and cofactors

ID	Name	Formula	Copies
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	200
CLR	Cholesterol	C27 H46 O	20

Primary citation

Double superhelix model of high density lipoprotein. Wu, Z., Gogonea, V., Lee, X. et al. J Biol Chem (2009) 284:36605-36619. DOI 10.1074/jbc.M109.039537 · PubMed

Other PDB entries of the same protein (UniProt P02647 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7KJR 2.08 Å, Cryo-EM structure of SARS-CoV-2 ORF3a
9PVY 2.15 Å, Cryo-EM structure of cardiac amyloid fibril from a variant apolipoprotein A-I L90P…
3R2P 2.2 Å, 2.2 Angstrom Crystal Structure of C Terminal Truncated Human Apolipoprotein A-I Reveals…
9PVZ 2.3 Å, Cryo-EM structure of cardiac amyloid fibril from a variant apolipoprotein A-I R173P…
8VXJ 2.7 Å, The crystal structure of human apolipoprotein A-I in complex with Fab 55201
9PW3 2.73 Å, Cryo-EM structure of renal amyloid fibril from a variant apolipoprotein A-I R173P…
8EQS 3.1 Å, Structure of SARS-CoV-1 Orf3a in late endosome/lysosome-like environment, MSP1D1 nanodisc
1AV1 4.0 Å, Crystal structure of human apolipoprotein a-I
4V6M 7.1 Å, Structure of the ribosome-SecYE complex in the membrane environment
9MXZ 9.8 Å, Lecithin:Cholesterol Acyltransferase Bound to Apolipoprotein A-I dimer in HDL
1GW3 The helix-hinge-helix structural motif in human apolipoprotein a-I determined by NMR…
1GW4 The helix-hinge-helix structural motif in human apolipoprotein a-I determined by NMR…

Browse structure collections

About this viewer

MolViewer shows 3K2S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.