3K7W: Protein phosphatase 2A core complex

Protein phosphatase 2A core complex bound to dinophysistoxin-2. Determined by X-ray diffraction at 2.96 Å resolution. Released 3 Nov 2009.

Method: X-ray diffraction
Resolution: 2.96 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,948
Mol. weight: 102.22 kDa
Ligands: MN, XT2
Released: 3 Nov 2009

Explore 3K7W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3K7W contains 75 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 60 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
β-strand	17	1	1
β-strand	27	1	1
α-helix	29-32	4
α-helix	38-41	4
α-helix	44-46	3
α-helix	47-51	5
α-helix	52-57	6
α-helix	63-73	11
α-helix	78-80	3
α-helix	83-89	7
α-helix	90-97	8
α-helix	103-116	14
α-helix	121-123	3
α-helix	124-128	5
α-helix	129-136	8
α-helix	142-145	4
α-helix	146-150	5
α-helix	151-154	4
α-helix	160-174	15
α-helix	179-194	16
α-helix	198-200	3
α-helix	201-205	5
α-helix	206-213	8
α-helix	218-234	17
α-helix	237-243	7
α-helix	245-251	7
α-helix	257-265	9
α-helix	267-274	8
α-helix	276-278	3
α-helix	279-283	5
α-helix	284-291	8
α-helix	296-312	17
α-helix	318-321	4
α-helix	322-326	5
α-helix	327-333	7
α-helix	339-346	8
α-helix	349-351	3
α-helix	357-360	4
α-helix	361-365	5
α-helix	366-373	8
α-helix	378-386	9
α-helix	389-394	6
α-helix	397-411	15
α-helix	419-424	6
α-helix	427-434	8
α-helix	436-438	3
α-helix	439-443	5
α-helix	444-449	6
α-helix	450-452	3
α-helix	456-481	26
α-helix	483-487	5
α-helix	488-491	4
α-helix	495-520	26
α-helix	522-527	6
α-helix	528-530	3
α-helix	534-547	14
α-helix	548-550	3
α-helix	553-555	3
α-helix	556-560	5
α-helix	561-567	7
α-helix	573-586	14

Chain C: 15 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	7-17	11
α-helix	21-24	4
α-helix	25-40	16
β-strand	45-48	4	2
α-helix	49	1
β-strand	52-55	4	3
α-helix	62-72	11
β-strand	80-82	3	3
α-helix	93-106	14
β-strand	111-113	3	3
α-helix	123-125	3
α-helix	129-137	9
α-helix	141-149	9
β-strand	156-159	4	2
β-strand	163-166	4	2
α-helix	177-182	6
α-helix	189-190	2
α-helix	194-200	7
β-strand	202-203	2	4
β-strand	209-211	3	4
β-strand	218-220	3	4
α-helix	222-232	11
β-strand	236-239	4	2
β-strand	248-251	4	2
β-strand	256-259	4	2
α-helix	265-267	3
β-strand	273-278	6	3
β-strand	284-289	6	3
α-helix	290-292	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform	A	protein	589	Homo sapiens	P30153 (AlphaFold model)
Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform	C	protein	309	Homo sapiens	P67775 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3K7W_1 Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (chains A)
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA

Sequence of entity 2 (C), FASTA

>3K7W_2 Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform (chains C)
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL

Ligands and cofactors

ID	Name	Formula	Copies
MN	Manganese (II) ion	Mn	2
XT2	(2R)-2-hydroxy-3-[(2S,5R,6R,8S)-5-hydroxy-8-{(1R,2E)-3-[(2R,4a'R,5R,6'S,8'R,8a'…	C44 H68 O13	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

A structural basis for the reduced toxicity of dinophysistoxin-2. Huhn, J., Jeffrey, P.D., Larsen, K. et al. Chem Res Toxicol (2009) 22:1782-1786. DOI 10.1021/tx9001622 · PubMed

Other PDB entries of the same protein (UniProt P30153 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1B3U 2.3 Å, Crystal structure of constant regulatory domain of human PP2A, PR65ALPHA
4I5L 2.43 Å, Structural mechanism of trimeric PP2A holoenzyme involving PR70: insight for Cdc6…
8TWE 2.55 Å, Cryo-EM structure of the PP2A:B55-FAM122A complex, B55 body
2IE4 2.6 Å, Structure of the Protein Phosphatase 2A Core Enzyme Bound to okadaic acid
9C6B 2.6 Å, PP2A:B55-p107 substrate complex
8TWI 2.69 Å, Cryo-EM structure of the PP2A:B55-FAM122A complex, PP2Ac body
8U1X 2.7 Å, The structure of the PP2A-B56Delta holoenzyme mutant - E197K
9C7T 2.7 Å, PP2A:B55-Eya3 substrate complex
8TTB 2.77 Å, Cryo-EM structure of the PP2A:B55-ARPP19 complex
8SO0 2.8 Å, Cryo-EM structure of the PP2A:B55-FAM122A complex
2IE3 2.8 Å, Structure of the Protein Phosphatase 2A Core Enzyme Bound to Tumor-inducing Toxins
3C5W 2.8 Å, Complex between PP2A-specific methylesterase PME-1 and PP2A core enzyme

Browse structure collections

About this viewer

MolViewer shows 3K7W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.