Crystal structure of PAmCherry1 in the dark state. Determined by X-ray diffraction at 1.5 Å resolution. Released 17 Nov 2009.
Explore 3KCS in 3D Show helices and sheets RCSB PDB PDBe
3KCS contains 8 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-22 | 11 | 1 |
| β-strand | 25-36 | 12 | 1 |
| β-strand | 41-50 | 10 | 1 |
| α-helix | 52 | 1 | |
| α-helix | 54 | 1 | |
| α-helix | 58-60 | 3 | |
| α-helix | 62-64 | 3 | |
| α-helix | 70-72 | 3 | |
| β-strand | 74 | 1 | 1 |
| α-helix | 82-85 | 4 | |
| β-strand | 91-99 | 9 | 1 |
| β-strand | 104-114 | 11 | 1 |
| β-strand | 117-127 | 11 | 1 |
| β-strand | 140-143 | 4 | 2 |
| α-helix | 144-145 | 2 | |
| β-strand | 146-153 | 8 | 1 |
| β-strand | 156-161 | 6 | 1 |
| β-strand | 164-167 | 4 | 2 |
| β-strand | 172-174 | 3 | 2 |
| β-strand | 175-183 | 9 | 1 |
| α-helix | 188-192 | 5 | |
| β-strand | 193-204 | 12 | 1 |
| β-strand | 210-220 | 11 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PAmCherry1 protein | A | protein | 234 | Discosoma sp. | D1MPT3 (AlphaFold model) |
>3KCS_1 PAmCherry1 protein (chains A) MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHVFEIEGEGEGRPYEGTQTAKLKVTKGGPLP FTWDILSPQFXSNAYVKHPADIPDYFKLSFPEGFKWERVMKFEDGGVVTVTQDSSLQDGE FIYKVKLRGTNFPSDGPVMQKKTMGWEALSERMYPEDGALKGEVKPRVKLKDGGHYDAEV KTTYKAKKPVQLPGAYNVNRKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
Photoactivation mechanism of PAmCherry based on crystal structures of the protein in the dark and fluorescent states. Subach, F.V., Malashkevich, V.N., Zencheck, W.D. et al. Proc Natl Acad Sci U S A (2009) 106:21097-21102. DOI 10.1073/pnas.0909204106 · PubMed
Other PDB entries of the same protein (UniProt D1MPT3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3KCS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.