3KL4: Signal recognition 54 kDa protein

Recognition of a signal peptide by the signal recognition particle. Determined by X-ray diffraction at 3.5 Å resolution. Released 31 Mar 2010.

Method: X-ray diffraction
Resolution: 3.5 Å
Organisms: Sulfolobus solfataricus, Saccharomyces cerevisiae
Chains: 2
Atoms: 3,385
Mol. weight: 53.04 kDa
Released: 31 Mar 2010

Explore 3KL4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KL4 contains 24 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	5-12	8
α-helix	19-36	18
α-helix	41-57	17
α-helix	59-61	3
α-helix	66-82	17
β-strand	97-101	5	1
α-helix	109-122	14
β-strand	127-132	6	1
α-helix	137-148	12
β-strand	154-155	2	1
α-helix	163-173	11
β-strand	181-186	6	1
α-helix	197-209	13
β-strand	213-219	7	1
α-helix	220-226	7
α-helix	227-236	10
β-strand	240-245	6	1
α-helix	247-249	3
α-helix	253-263	11
β-strand	266-271	6	1
β-strand	279-281	3	1
α-helix	284-292	9
α-helix	296-306	11
α-helix	329-341	13
α-helix	347-350	4
α-helix	363-368	6
α-helix	377-382	6
α-helix	392-394	3
α-helix	397-407	11
α-helix	411-429	19

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	452-455	4
α-helix	460-465	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition 54 kDa protein	A	protein	433	Sulfolobus solfataricus	Q97ZE7 (AlphaFold model)
Signal peptide of yeast dipeptidyl aminopeptidase B	B	protein	42	Saccharomyces cerevisiae	P18962 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3KL4_1 Signal recognition 54 kDa protein (chains A)
MGLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEK
PPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYF
YKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKM
DIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPI
GSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILGMGDIES
ILEKVKGLEEYDKIQKKMEDVMEGKGKLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIML
PTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLE
WYNNMNRLLKMVK

Sequence of entity 2 (B), FASTA

>3KL4_2 Signal peptide of yeast dipeptidyl aminopeptidase B (chains B)
ARSGSGSGSGSKLIRVGIILVLLIWGTVLLLKSIPHHHHHHH

Primary citation

Recognition of a signal peptide by the signal recognition particle. Janda, C.Y., Li, J., Oubridge, C. et al. Nature (2010) 465:507-510. DOI 10.1038/nature08870 · PubMed

Other PDB entries of the same protein (UniProt Q97ZE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5L3S 1.9 Å, Structure of the GTPase heterodimer of crenarchaeal SRP54 and FtsY
5L3V 2.3 Å, Structure of the crenarchaeal SRP54 GTPase bound to GDP
1QZX 4.0 Å, Crystal structure of the complete core of archaeal SRP and implications for inter-domain…
1QZW 4.1 Å, Crystal structure of the complete core of archaeal SRP and implications for inter-domain…
3ZN8 12.0 Å, Structural Basis of Signal Sequence Surveillance and Selection by the SRP-SR Complex
2IY3 16.0 Å, Structure of the E. Coli Signal Regognition Particle

Browse structure collections

About this viewer

MolViewer shows 3KL4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.