3KML: Circular Permutant of the Tobacco Mosaic Virus

Circular Permutant of the Tobacco Mosaic Virus. Determined by X-ray diffraction at 3.01 Å resolution. Released 16 Feb 2010.

Method: X-ray diffraction
Resolution: 3.01 Å
Organism: Tobacco mosaic virus
Chains: 17
Atoms: 18,700
Mol. weight: 301.25 kDa
Released: 16 Feb 2010

Explore 3KML in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KML contains 119 α-helices and 136 β-strands across 17 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P and Q: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	15-17	3
α-helix	19-36	18
β-strand	40-41	2	1
α-helix	43-50	8
β-strand	53-55	3	2
β-strand	63-65	3	2
α-helix	69-72	4
β-strand	79-80	2	1
α-helix	82-92	11
α-helix	100-112	13
β-strand	115	1	1
β-strand	119	1	3
β-strand	122	1	3
β-strand	130-132	3	1
α-helix	138-148	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coat protein	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q	protein	161	Tobacco mosaic virus	P69687

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q), FASTA

>3KML_1 Coat protein (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q)
GANPTTAETLDATRRVDDATVAIRCAINNLIVELIRGTGSYNRSSFESSSGLVWTSGPAG
EGSYSITTPSQFVFLSSAWADPIELINLCTNALGNQFQTQQARTVVQRQFSEVWKPSPQV
TVRFPDSDFKVYRYNAVLDPLVTALLGAFDTRNRIIEVENQ

Primary citation

Nanoscale protein assemblies from a circular permutant of the tobacco mosaic virus. Dedeo, M.T., Duderstadt, K.E., Berger, J.M. et al. Nano Lett (2010) 10:181-186. DOI 10.1021/nl9032395 · PubMed

Other PDB entries of the same protein (UniProt P69687), best resolution first:

6SAE 1.9 Å, Cryo-EM structure of TMV in water
6R7M 1.92 Å, Tobacco Mosaic Virus (TMV)
6SAG 2.0 Å, Cryo-EM structure of TMV with Ca2+ at low pH
6I5A 2.3 Å, Tobacco Mosaic Virus
6RLP 2.3 Å, Cryo-EM reconstruction of TMV coat protein
1EI7 2.45 Å, Tmv coat protein refined from the 4-layer aggregate
8EAW 2.8 Å, An asymmetric disk assembly formed by tandem dimers of the tobacco mosaic viral capsid…
2TMV 2.9 Å, Visualization of protein-nucleic acid interactions in a virus. Refined structure of…
6X0Q 3.0 Å, A Circular Permutant of the Tobacco Mosaic Virus (TMV) mutant Q101H coordinated with heme
6X0R 3.0 Å, A Circular Permutant of the Tobacco Mosaic Virus (TMV) mutant Q101H
4GQH 3.06 Å, The Conformations and Interactions of the Four-Layer Aggregate Revealed by X-ray…
3J06 3.3 Å, CryoEM Helical Reconstruction of TMV

Browse structure collections

About this viewer

MolViewer shows 3KML directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.