3KS2: Chaperone protein ipgC

Name: PDB 3KS2: Crystal Structure of Type-III Secretion Chaperone IpgC from Shigella flexneri (residues 10-155)
Published: 2010-08-25
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal Structure of Type-III Secretion Chaperone IpgC from Shigella flexneri (residues 10-155). Determined by X-ray diffraction at 3.3 Å resolution. Released 25 Aug 2010.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Shigella flexneri
Chains: 18
Atoms: 20,052
Mol. weight: 308.33 kDa
Released: 25 Aug 2010

Explore 3KS2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KS2 contains 126 α-helices and 0 β-strands across 18 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q and R: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	33-48	16
α-helix	52-65	14
α-helix	70-82	13
α-helix	86-98	13
α-helix	105-116	12
α-helix	120-133	14
α-helix	137-151	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chaperone protein ipgC	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R	protein	151	Shigella flexneri	P0A2U4 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R), FASTA

>3KS2_1 Chaperone protein ipgC (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R)
GSTGSSISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCI
YDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAK
ECFELVIQHSNDEKLKIKAQSYLDAIQDIKE

Primary citation

Evidence for alternative quaternary structure in a bacterial Type III secretion system chaperone. Barta, M.L., Zhang, L., Picking, W.L. et al. BMC Struct Biol (2010) 10:21-21. DOI 10.1186/1472-6807-10-21 · PubMed

Other PDB entries of the same protein (UniProt P0A2U4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7P42 1.5 Å, Crystal structure of IpgC in complex with a follow-up compound based on J2
7PE0 1.5 Å, Crystal structure of IpgC in complex with J52
7PEF 1.54 Å, Crystal structure of IpgC in complex with DMSO
7NRG 1.57 Å, Crystal structure of a shortened IpgC variant in complex with…
6SCB 1.58 Å, Crystal structure of a shortened IpgC variant with two bound Magnesium and two bound…
7O6S 1.58 Å, Crystal structure of a shortened IpgC variant in complex with…
7B1U 1.59 Å, Crystal structure of a shortened IpgC variant in complex with…
7NL8 1.59 Å, Crystal structure of a shortened IpgC variant in complex with 3-methylbenzohydrazide
7OWV 1.59 Å, Crystal structure of IpgC in complex with a follow-up compound based on J20
7AXY 1.63 Å, Crystal structure of a shortened IpgC variant in complex with…
7AZV 1.68 Å, Crystal structure of a shortened IpgC variant in complex with…
7O04 1.74 Å, Crystal structure of a shortened IpgC variant in complex with…

Browse structure collections

About this viewer

MolViewer shows 3KS2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.