Crystal Structure of the CBX3 Chromo Shadow Domain. Determined by X-ray diffraction at 1.77 Å resolution. Released 8 Dec 2009.
Explore 3KUP in 3D Show helices and sheets RCSB PDB PDBe
3KUP contains 16 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 116-119 | 4 | |
| α-helix | 121-122 | 2 | |
| β-strand | 123-130 | 8 | 1 |
| β-strand | 137-142 | 6 | 1 |
| β-strand | 149-152 | 4 | 1 |
| α-helix | 153-159 | 7 | |
| α-helix | 161-171 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 116-119 | 4 | |
| α-helix | 121-122 | 2 | |
| β-strand | 123-130 | 8 | 2 |
| β-strand | 137-142 | 6 | 2 |
| β-strand | 148-152 | 5 | 2 |
| α-helix | 153-159 | 7 | |
| α-helix | 161-172 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 116-119 | 4 | |
| α-helix | 121-122 | 2 | |
| β-strand | 123-130 | 8 | 3 |
| β-strand | 137-142 | 6 | 3 |
| β-strand | 148-152 | 5 | 3 |
| α-helix | 153-159 | 7 | |
| α-helix | 161-171 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chromobox protein homolog 3 | A, B, C, D | protein | 65 | Homo sapiens | Q13185 (AlphaFold model) |
>3KUP_1 Chromobox protein homolog 3 (chains A, B, C, D) GAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFY EERLT
Crystal Structure of the CBX3 Chromo Shadow Domain. Tempel, W., Li, Z., Li, Y. et al. To be published.
Other PDB entries of the same protein (UniProt Q13185 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3KUP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.