Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the binding region of Paip2. Determined by X-ray diffraction at 1.5 Å resolution. Released 9 Feb 2010.
Explore 3KUT in 3D Show helices and sheets RCSB PDB PDBe
3KUT contains 14 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 547-550 | 4 | |
| α-helix | 555-573 | 19 | |
| α-helix | 575-577 | 3 | |
| α-helix | 578-585 | 8 | |
| α-helix | 590-598 | 9 | |
| α-helix | 600-625 | 26 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 547-551 | 5 | |
| α-helix | 555-573 | 19 | |
| α-helix | 575-577 | 3 | |
| α-helix | 578-585 | 8 | |
| α-helix | 590-596 | 7 | |
| α-helix | 600-622 | 23 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 115-118 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polyadenylate-binding protein 1 | A, B | protein | 88 | Homo sapiens | P11940 (AlphaFold model) |
| PAIP2 protein | C, D | protein | 17 | Homo sapiens | Q9BPZ3 (AlphaFold model) |
>3KUT_1 Polyadenylate-binding protein 1 (chains A, B) GPLGSPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLE SPESLRSKVDEAVAVLQAHQAKEAAQKA
>3KUT_2 PAIP2 protein (chains C, D) SNLNPNAAEFVPGVKYG
Molecular Determinants of PAM2 Recognition by the MLLE Domain of Poly(A)-Binding Protein. Kozlov, G., Menade, M., Rosenauer, A. et al. J Mol Biol (2010) 397:397-407. DOI 10.1016/j.jmb.2010.01.032 · PubMed
Other PDB entries of the same protein (UniProt P11940 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3KUT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.