Crystal structure of the second RRM domain of human PABPC1 at pH 6.0. Determined by X-ray diffraction at 1.9 Å resolution. Released 8 Aug 2012.
Explore 4F25 in 3D Show helices and sheets RCSB PDB PDBe
4F25 contains 5 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 100-104 | 5 | 1 |
| α-helix | 112-119 | 8 | |
| α-helix | 120-122 | 3 | |
| β-strand | 125-133 | 9 | 1 |
| β-strand | 136-145 | 10 | 1 |
| α-helix | 148-158 | 11 | |
| β-strand | 162-163 | 2 | 2 |
| β-strand | 166-167 | 2 | 2 |
| α-helix | 168 | 1 | |
| β-strand | 169-172 | 4 | 1 |
| α-helix | 175-177 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polyadenylate-binding protein 1 | A | protein | 115 | Homo sapiens | P11940 (AlphaFold model) |
>4F25_1 Polyadenylate-binding protein 1 (chains A) GPLGSGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAER AIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGPGSTRAAAS
Interdomain Allostery Promotes Assembly of the Poly(A) mRNA Complex with PABP and eIF4G. Safaee, N., Kozlov, G., Noronha, A.M. et al. Mol Cell (2012) 48:375-386. DOI 10.1016/j.molcel.2012.09.001 · PubMed
Other PDB entries of the same protein (UniProt P11940 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4F25 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.