7BN3: C-terminal domain of PABPC1

Crystal structure of C-terminal domain of PABPC1 in complex with Nucleoprotein from Human Coronavirus 229E. Determined by X-ray diffraction at 1.93 Å resolution. Released 2 Mar 2022.

Method: X-ray diffraction
Resolution: 1.93 Å
Organisms: Homo sapiens, Human coronavirus 229E
Chains: 6
Atoms: 2,253
Mol. weight: 35.08 kDa
Released: 2 Mar 2022

Explore 7BN3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BN3 contains 18 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	547-551	5
α-helix	555-573	19
α-helix	578-586	9
α-helix	590-598	9
α-helix	600-625	26

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	547-552	6
α-helix	555-573	19
α-helix	578-586	9
α-helix	590-598	9
α-helix	600-625	26

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	547-550	4
α-helix	555-573	19
α-helix	578-586	9
α-helix	590-598	9
α-helix	600-625	26

Chains D, E and F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of Polyadenylate-binding protein 1	A, B, C	protein	92	Homo sapiens	P11940 (AlphaFold model)
Nucleoprotein from Human Coronavirus 229E	D, E, F	protein	17	Human coronavirus 229E	P15130 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>7BN3_1 Isoform 2 of Polyadenylate-binding protein 1 (chains A, B, C)
GSGTAAQPAPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELL
HMLESPESLRSKVDEAVAVLQAHQAKEAAAAA

Sequence of entity 2 (D, E, F), FASTA

>7BN3_2 Nucleoprotein from Human Coronavirus 229E (chains D, E, F)
HPLLNPSALEFNPSQTY

Primary citation

Large-scale phage-based screening reveals extensive pan-viral mimicry of host short linear motifs. Mihalic, F., Simonetti, L., Giudice, G. et al. Nat Commun (2023) 14. DOI 10.1038/s41467-023-38015-5

Other PDB entries of the same protein (UniProt P11940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KUJ 1.4 Å, Crystal structure of C-terminal domain of PABPC1 in complex with binding region of eRF3a
3KUS 1.4 Å, Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the…
2X04 1.49 Å, Crystal structure of the PABC-TNRC6C complex
3KTP 1.5 Å, Structural basis of GW182 recognition by poly(A)-binding protein
3KUT 1.5 Å, Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the…
3KTR 1.7 Å, Structural basis of ataxin-2 recognition by poly(A)-binding protein
3PTH 1.7 Å, The PABC1 MLLE domain bound to the variant PAM2 motif of LARP4B
3PKN 1.8 Å, Crystal structure of MLLE domain of poly(A) binding protein in complex with PAM2 motif…
4F25 1.9 Å, Crystal structure of the second RRM domain of human PABPC1 at pH 6.0
5DX1 1.93 Å, Crystal structure of CARM1, sinefungin, and PABP1 peptide (R455)
5DX8 1.94 Å, Crystal structure of CARM1, sinefungin, and methylated PABP1 peptide (R455)
4F02 2.0 Å, Crystal structure of the PABP-binding site of eIF4G in complex with RRM1-2 of PABP and…

Browse structure collections

About this viewer

MolViewer shows 7BN3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.