3KZY: SNAP-tag

Crystal structure of SNAP-tag. Determined by X-ray diffraction at 1.9 Å resolution. Released 15 Dec 2010.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,759
Mol. weight: 39.01 kDa
Ligands: ZN
Released: 15 Dec 2010

Explore 3KZY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KZY contains 18 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
β-strand	19-24	6	1
β-strand	27-33	7	1
α-helix	58-71	14
α-helix	73-78	6
α-helix	80-83	4
β-strand	84	1	1
α-helix	87-89	3
α-helix	94-105	12
β-strand	112-113	2	2
α-helix	114-120	7
α-helix	127-135	9
α-helix	145-147	3
β-strand	148-149	2	2
β-strand	151	1	3
β-strand	154	1	3
α-helix	162-171	10

Chain B: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	4
β-strand	15	1	5
β-strand	17	1	5
β-strand	19-24	6	4
β-strand	27-33	7	4
α-helix	58-71	14
α-helix	73-78	6
α-helix	80-83	4
β-strand	84	1	4
α-helix	87-90	4
α-helix	94-105	12
β-strand	112-113	2	6
α-helix	114-120	7
α-helix	127-135	9
β-strand	140	1	7
β-strand	143	1	7
α-helix	145-147	3
β-strand	148-149	2	6
β-strand	151	1	8
β-strand	154	1	8
α-helix	162-171	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Methylated-DNA--protein-cysteine methyltransferase	A, B	protein	182	Homo sapiens	E5BBQ0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3KZY_1 Methylated-DNA--protein-cysteine methyltransferase (chains A, B)
GPGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIIFLGKGTSAADAVEVPAPAAVLGGPE
PLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHL
AALAGNPAATAAVKTALSGNPVPILIPCHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLG
KR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

SNAP-tag structure. Schmitt, S., Mollwitz, B., Pojer, F. et al. To be published.

Other PDB entries of the same protein (UniProt E5BBQ0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Y8P 2.3 Å, Crystal structure of SNAP-tag labeled with a benzyl-tetramethylrhodamine fluorophore
8TK7 2.53 Å, Myxococcus xanthus EncA protein shell with compartmentalized SNAP-tag cargo protein
9Q2H 2.74 Å, Rad55-Rad57-SHU homologous recombination complex
9Q2I 3.0 Å, Rad55-Rad57-SHU homologous recombination complex
9Q2C 3.06 Å, Rad55-Rad57-SHU-Rad51 bound to ssDNA with AMP-PNP
9Q2F 3.06 Å, Rad55-Rad57-SHU-Rad51-Rad51 bound to ssDNA with AMP-PNP
8DD7 3.3 Å, The Cryo-EM structure of Drosophila Cryptochrome in complex with Timeless
9Q2E 3.44 Å, Rad55-Rad57-SHU bound to ssDNA
9Q2L 3.7 Å, Rad55-Rad57(E161Q)-SHU-3xRad51 bound to ssDNA with ATP
6RLA 3.9 Å, Structure of the dynein-2 complex; motor domains
6SC2 3.9 Å, Structure of the dynein-2 complex; IFT-train bound model
6RLB 4.5 Å, Structure of the dynein-2 complex; tail domain

Browse structure collections

About this viewer

MolViewer shows 3KZY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.