3L1C: Kinesin-14 Protein Ncd, T436S Mutant

Kinesin-14 Protein Ncd, T436S Mutant. Determined by X-ray diffraction at 2.75 Å resolution. Released 18 Aug 2010.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Drosophila melanogaster
Chains: 2
Atoms: 5,768
Mol. weight: 88.1 kDa
Ligands: ADP, MG
Released: 18 Aug 2010

Explore 3L1C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L1C contains 26 α-helices and 33 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	293-346	54
β-strand	349-355	7	1
α-helix	356-359	4
β-strand	369-371	3	2
β-strand	377-381	5	2
β-strand	395-397	3	2
β-strand	400-402	3	1
α-helix	408-423	16
β-strand	427-433	7	1
α-helix	440-444	5
β-strand	446-447	2	3
β-strand	450-451	2	3
α-helix	453-468	16
α-helix	469-471	3
β-strand	473-484	12	1
β-strand	489-491	3	1
β-strand	502-504	3	4
β-strand	512-514	3	4
β-strand	520-521	2	1
α-helix	525-537	13
β-strand	554-565	12	1
β-strand	570-580	11	1
α-helix	581-583	3
α-helix	599-614	16
α-helix	622-624	3
α-helix	626-630	5
α-helix	632-634	3
β-strand	640-647	8	1
α-helix	654-668	15

Chain B: 13 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	293-346	54
β-strand	350-355	6	5
α-helix	356-359	4
β-strand	367	1	6
β-strand	369-372	4	7
β-strand	377-381	5	7
α-helix	385-388	4
β-strand	395-397	3	7
β-strand	400-402	3	5
α-helix	408-423	16
β-strand	428-434	7	5
α-helix	440-444	5
α-helix	453-461	9
β-strand	475-481	7	8
β-strand	484	1	9
β-strand	489	1	9
α-helix	525-535	11
β-strand	554	1	9
β-strand	557-563	7	8
β-strand	573-575	3	8
β-strand	576	1	5
β-strand	579	1	5
α-helix	603-612	10
α-helix	621-624	4
α-helix	626-630	5
α-helix	632-635	4
β-strand	640-647	8	5
β-strand	650	1	6
α-helix	651-653	3
α-helix	654-667	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein claret segregational	A, B	protein	383	Drosophila melanogaster	P20480 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3L1C_1 Protein claret segregational (chains A, B)
MHAALSTEVVHLRQRTEELLRCNEQQAAELETCKEQLFQSNMERKELHNTVMDLRGNIRV
FCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDI
FEMVSPLIQSALDGYNICIFAYGQSGSGKTYTMDGVPESVGVIPRTVDLLFDSIRGYRNL
GWEYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRHL
MHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVGSINLVDLAGSESPKTST
RMTETKNINRSLSELTNVILALLQKQDHIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQ
DCFQESVKSLRFAASVNSCKMTK

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2
MG	Magnesium ion	Mg	2

Primary citation

A kinesin motor in a force-producing conformation. Heuston, E., Bronner, C.E., Kull, F.J. et al. BMC Struct Biol (2010) 10:19-19. DOI 10.1186/1472-6807-10-19 · PubMed

Other PDB entries of the same protein (UniProt P20480 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3U06 2.35 Å, Crystal structure of the kinesin-14 NcdG347D
1N6M 2.5 Å, Rotation of the stalk/neck and one head in a new crystal structure of the kinesin motor…
2NCD 2.5 Å, Ncd (non-claret disjunctional) dimer from D. Melanogaster
5W3D 2.79 Å, The structure of kinesin-14 wild-type Ncd-ADP dimer
1CZ7 2.9 Å, The crystal structure of a minus-end directed microtubule motor protein ncd reveals…
5HLE 2.9 Å, Structural basis of backwards motion in kinesin-14: minus-end directed nKn664 in the ADP…
8YUE 3.15 Å, Crystal structure of the kinesin-14 motor protein from Drosophila melanogaster
8YY3 3.24 Å, Kinesin-14 in nucleotide-free state bound to 14 PF Microtubule
8YY2 3.6 Å, Kinesin-14 in nucleotide-free state bound to 13 PF Microtubule
8YY5 3.99 Å, Kinesin-14 with AlF3 bound to 14 PF Microtubule
8YY4 4.02 Å, Kinesin-14 with AlF3 bound to 13 PF Microtubule
5HNZ 5.8 Å, Structural basis of backwards motion in kinesin-14: plus-end directed nKn669 in the…

Browse structure collections

About this viewer

MolViewer shows 3L1C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.